DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wntD and Wnt6

DIOPT Version :9

Sequence 1:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001101696.1 Gene:Wnt6 / 316526 RGDID:1304559 Length:365 Species:Rattus norvegicus


Alignment Length:312 Identity:79/312 - (25%)
Similarity:115/312 - (36%) Gaps:77/312 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KGLKQALDSCQQSFQWQRWNCPS----------QDFVQKNSKPEENSPNREDVYVAAISMAAIVH 96
            :|.:..:..||..|:::||||.|          ||.             ||..:|.||:.|...|
  Rat    67 RGARLGVRECQFQFRFRRWNCSSHSKAFGRVLQQDI-------------RETAFVFAITAAGASH 118

  Fly    97 TLTKDCANGVIAGCGC----------TENALNVPCAHEPTKALEQY----------EKHFGS--- 138
            .:|:.|:.|.:..|||          ....|..|....||.:.:..          :..||.   
  Rat   119 AVTQACSMGELLQCGCQAPRGRAPPRPSGLLGTPGPPGPTGSPDASAAWEWGGCGDDVDFGDEKS 183

  Fly   139 ----------GSGAIG-----HNRRVVGALLQRS-LEQECRCKQPGAVQGECQEEECVAVLKPFE 187
                      |.|.|.     ||.. .|.|..|| ...||:|.   .:.|.|....|...|.||.
  Rat   184 RLFMDAQHKRGRGDIRALVQLHNNE-AGRLAVRSHTRTECKCH---GLSGSCALRTCWQKLPPFR 244

  Fly   188 AIAQDLLQMYDDAIQLEGASSNLKIMWQNIPLD-----SLVFMQDSPNYCERDATGLWKGTRGRQ 247
            .:...||:.:..|.::.|.:....::.....|.     .|::..|||::|..:......|||||.
  Rat   245 EVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTGSPGTRGRA 309

  Fly   248 CSKDGSGSLEERLSCQQLCRVCGYRVRSQHVRTERRCNCKLVWGFRLQCDVC 299
            |    :.|..:...|..||  ||...|.:.|:.|..|.|:..|...:||..|
  Rat   310 C----NSSAPDLSGCDLLC--CGRGHRQESVQLEENCLCRFHWCCVVQCHRC 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wntDNP_650272.1 wnt 41..308 CDD:302926 79/312 (25%)
Wnt6NP_001101696.1 Wnt_Wnt6 35..365 CDD:381712 79/312 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.