DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wntD and Wnt7b

DIOPT Version :9

Sequence 1:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster
Sequence 2:XP_038935225.1 Gene:Wnt7b / 315196 RGDID:1311441 Length:353 Species:Rattus norvegicus


Alignment Length:312 Identity:82/312 - (26%)
Similarity:132/312 - (42%) Gaps:66/312 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ITGKGLKQALDSCQQSFQWQRWNCPSQD----FVQKNSKPEENSPNREDVYVAAISMAAIVHTLT 99
            :.|:|.:..:|.||..|::.||||.:..    |.|     |....:||..:..||:.|.:.|.:|
  Rat    65 VIGEGAQMGIDECQHQFRFGRWNCSALGEKTVFGQ-----ELRVGSREAAFTYAITAAGVAHAVT 124

  Fly   100 KDCANGVIAGCGCTENALNVPCAHEPTKALEQYEKHFGSGSGA-----IGHNRRVVGA------- 152
            ..|:.|.::.|||.         .|......|.|.....|..|     |..:||.|.|       
  Rat   125 AACSQGNLSNCGCD---------REKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNA 180

  Fly   153 --------------LLQRSLEQECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQMYDDAIQL 203
                          :|:..::.||:|.   .|.|.|..:.|...|..|..:...|.:.|:.|:|:
  Rat   181 RRLMNLHNNEAGRKVLEDRMKLECKCH---GVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQV 242

  Fly   204 EGASSN-------LKI----MWQNIPLDS-LVFMQDSPNYCERDATGLWKGTRGRQCSKDGSGSL 256
            |...::       |:|    .:|. |::: ||:::.||||||.||.....||:||.|::...|: 
  Rat   243 EVVRASRLRQPTFLRIKQLRSYQK-PMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGA- 305

  Fly   257 EERLSCQQLCRVCGYRVRSQHVRTERRCNCKLVWGFRLQCDVCVQLERQYSC 308
               ..|..:|  ||....:.......:||||..|...::|:.|.:....::|
  Rat   306 ---DGCDTMC--CGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTC 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wntDNP_650272.1 wnt 41..308 CDD:302926 81/308 (26%)
Wnt7bXP_038935225.1 wnt_Wnt7b 36..353 CDD:381724 82/312 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.