DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wntD and Wnt3a

DIOPT Version :9

Sequence 1:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001100475.2 Gene:Wnt3a / 303181 RGDID:1308057 Length:359 Species:Rattus norvegicus


Alignment Length:297 Identity:76/297 - (25%)
Similarity:121/297 - (40%) Gaps:43/297 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KGLKQALDSCQQSFQWQRWNCPSQDFVQKNSKPEENSPNREDVYVAAISMAAIVHTLTKDCANGV 106
            :|:|..:..||..|:.:||||.:.........|..:...||..:|.||:.|.:...:|:.||.|.
  Rat    75 EGVKAGIQECQHQFRGRRWNCTTVSNSLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGS 139

  Fly   107 IAGCGCTENALNVP--------CAHE-------PTKALEQYEKHFGSGSGAIGHNRRVVGALLQR 156
            .|.|||:......|        |:.:       ..:..:..|....:.|....||.......:..
  Rat   140 AAICGCSSRLQGSPGEGWKWGGCSEDIEFGGMVSREFADARENRPDARSAMNRHNNEAGRQAIAS 204

  Fly   157 SLEQECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQMYDDAIQL--------EGASSNL--K 211
            .:..:|:|.   .:.|.|:.:.|......|..|...|...||.|.::        .|....|  :
  Rat   205 HMHLKCKCH---GLSGSCEVKTCWWSQPDFRTIGDFLKDKYDSASEMVVEKHRESRGWVETLRPR 266

  Fly   212 IMWQNIPLD-SLVFMQDSPNYCE-RDATGLWKGTRGRQCSKDGSGSLEERLSCQQLCRVCGYRVR 274
            ..:..:|.: .||:.:.|||:|| ...||.: |||.|.|:....| ::   .|..||  ||   |
  Rat   267 YTYFKVPTERDLVYYEASPNFCEPNPETGSF-GTRDRTCNVSSHG-ID---GCDLLC--CG---R 321

  Fly   275 SQHVRTERR---CNCKLVWGFRLQCDVCVQLERQYSC 308
            ..:.|||||   |:|...|...:.|..|.::...::|
  Rat   322 GHNARTERRREKCHCVFHWCCYVSCQECTRVYDVHTC 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wntDNP_650272.1 wnt 41..308 CDD:302926 75/295 (25%)
Wnt3aNP_001100475.2 WNT1 51..359 CDD:128408 76/297 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.