DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wntD and wnt10b

DIOPT Version :9

Sequence 1:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_835737.1 Gene:wnt10b / 30308 ZFINID:ZDB-GENE-980526-524 Length:427 Species:Danio rerio


Alignment Length:365 Identity:80/365 - (21%)
Similarity:131/365 - (35%) Gaps:117/365 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 DITG---KGLKQALDSCQQSFQWQRWNCPSQDFVQKNSK-PEE----NSPNREDVYVAAISMAAI 94
            |:|.   :|::.|:..||...:.|||||.|   ::.:.| |.:    |...||..:..::..|.:
Zfish    67 DVTASALQGIQVAIHECQHQLRDQRWNCSS---LENHGKLPHQSAILNRGFRESAFSLSLLAAGV 128

  Fly    95 VHTLTKDCANGVIAGCGCT---------------------------------EN----------- 115
            ||::...|:.|.:.||||.                                 ||           
Zfish   129 VHSVASACSLGKLRGCGCEAKRRLDDDKIRLKLTQLQLQTFQRSGVSLAGAGENTPELSSLHGSL 193

  Fly   116 ----------ALNVPCAHEPTKALEQYEKHFGSGSGAIG-------------------------H 145
                      :|..|...|.|...:.:|  :|..|..|.                         |
Zfish   194 PANLHSSHPMSLLKPLPDEVTMLQDTWE--WGGCSHDIRFGVRFSRDWLDSRGSPRDIHARTRIH 256

  Fly   146 NRRVVGALLQRSLEQECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQMYDDAIQLEGASSNL 210
            |.||...::..::.::|:|.   ...|.||.:.|..|...|..:...|.:.:..||.:...:.|.
Zfish   257 NNRVGRQVVTDNMRRKCKCH---GTSGSCQFKTCWYVSPEFRLVGSLLREKFLTAIFINSQNKNN 318

  Fly   211 KIMWQNI-------PL---------DSLVFMQDSPNYCERDATGLWKGTRGRQCSKDGSGSLEER 259
            .:.....       ||         ..||:.:.||::|:|:......||:||.|:|...|    .
Zfish   319 GVFNSRTGGSTGSDPLRGQRRRSISRELVYFEKSPDFCDREPAVDSLGTQGRICNKSSPG----M 379

  Fly   260 LSCQQLCRVCGYRVRSQHVRTERRCNCKLVWGFRLQCDVC 299
            ..|..||...|:.:..| .|:| ||:|:..|...:.|:.|
Zfish   380 DGCGSLCCGRGHNILKQ-ARSE-RCHCRFHWCCYVLCEEC 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wntDNP_650272.1 wnt 41..308 CDD:302926 78/362 (22%)
wnt10bNP_835737.1 wnt 50..427 CDD:306592 80/365 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.