DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wntD and wnt11

DIOPT Version :9

Sequence 1:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_571151.1 Gene:wnt11 / 30283 ZFINID:ZDB-GENE-980526-249 Length:352 Species:Danio rerio


Alignment Length:302 Identity:91/302 - (30%)
Similarity:126/302 - (41%) Gaps:72/302 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 CQQSFQWQRWNCPSQD---FVQKNSKPEENSPNREDVYVAAISMAAIVHTLTKDCANGVIAGCGC 112
            ||::|...||||.|.|   |:     |:.....||..:|.|:|.|||.||:.:.|.:|.:..|.|
Zfish    78 CQKTFTDMRWNCSSIDGPKFL-----PDLERGTRESAFVYALSAAAISHTIARACTSGDLRLCSC 137

  Fly   113 TENALNVP--------CAHE--------------PTKALEQYEKHFGSGSGAIG--HNRRVVGAL 153
            ......:|        ||..              |.|    .:|..||.:..:.  ||..|....
Zfish   138 GPIPGEIPEPGYRWGGCADNIHYGLLMGSKFSDAPMK----MKKKSGSHANKLMHLHNSEVGRQA 198

  Fly   154 LQRSLEQECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQMYDDAIQL----EGASSNLKIMW 214
            |:.:|..:|:|.   .|.|.|....|...|...:.||.||...|..|.::    .|....|    
Zfish   199 LRDALVMKCKCH---GVSGSCSIRTCWRGLLDLKDIAIDLKTKYLSATKVVHRPMGTRKQL---- 256

  Fly   215 QNIPLD---------SLVFMQDSPNYC-ERDATGLWKGTRGRQCSKDGSGSLEERLSCQQLCRVC 269
              :|.|         .||::|.||:|| :.|..|.: ||:.|||:|..|||    .||..:|  |
Zfish   257 --VPKDIDIRPVRENELVYLQSSPDYCMKNDKLGSF-GTQDRQCNKTSSGS----DSCDLMC--C 312

  Fly   270 GYRVRSQHVRTER---RCNCKLVWGFRLQCDVCVQLERQYSC 308
            |   |..:..|||   ||:||..|...:.|..|.:...:|.|
Zfish   313 G---RGYNPYTERVVERCHCKYHWCCYVTCKKCDKTVEKYVC 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wntDNP_650272.1 wnt 41..308 CDD:302926 90/300 (30%)
wnt11NP_571151.1 wnt 49..352 CDD:278536 91/302 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.