DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wntD and wnt10a

DIOPT Version :9

Sequence 1:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_571055.1 Gene:wnt10a / 30171 ZFINID:ZDB-GENE-990415-278 Length:442 Species:Danio rerio


Alignment Length:330 Identity:86/330 - (26%)
Similarity:134/330 - (40%) Gaps:82/330 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 DITG---KGLKQALDSCQQSFQWQRWNCPSQDFVQKNSKPEE----NSPNREDVYVAAISMAAIV 95
            |:|.   :|::.|:..||..|:..||||.|.:  .:|..|.|    :...||..:..||:.|.:|
Zfish   117 DVTASAIQGIQIAIHECQHQFRGHRWNCSSLE--TRNKIPYESVVFSRGFRESAFAYAIAAAGVV 179

  Fly    96 HTLTKDCANGVIAGCGCTE-------------NALNVPC------------AHEPTKAL------ 129
            |.::..||.|.:..|||.|             |.|.:..            .|.|.:||      
Zfish   180 HAVSNACAMGKLKACGCDEKRRGDEEAFRIKLNRLQLEAINRGKGMVHGVMEHFPAEALGPQDSW 244

  Fly   130 ------------EQYEKHFGSG--------SGAIGHNRRVVGALLQRSLEQECRCKQPGAVQGEC 174
                        |::.|.|...        |....||.||...::...:.::|:|.   ...|.|
Zfish   245 EWGGCSPNVEYGERFSKDFLDSRETYRDIHSRMRLHNNRVGRQVVVDHMRRKCKCH---GTSGSC 306

  Fly   175 QEEECVAVLKPFEAIAQDLLQMYDDAI----------QLEGASSNLKIMWQNIPLDSLVFMQDSP 229
            |.:.|..|...|..:...|.:.::.|.          |:|.|....:   :...::.||:.:.||
Zfish   307 QLKTCWQVTPEFRTVGSLLKERFNVATLIKAHNRNTGQVENAHHTHR---RRANINDLVYFEKSP 368

  Fly   230 NYCERDATGLWKGTRGRQCSKDGSGSLEERLSCQQLCRVCGYRVRSQHVRTERRCNCKLVWGFRL 294
            ::||||......||:||.|:|...|    ..:|:.||...|:.: .|..|:| |||||..|...:
Zfish   369 DFCERDLGSDSAGTQGRICNKTSQG----MDNCESLCCGRGHNI-LQQTRSE-RCNCKFHWCCYV 427

  Fly   295 QCDVC 299
            .|:.|
Zfish   428 VCEEC 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wntDNP_650272.1 wnt 41..308 CDD:302926 84/327 (26%)
wnt10aNP_571055.1 wnt 104..442 CDD:278536 86/330 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.