DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wntD and wnt8b

DIOPT Version :9

Sequence 1:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_571034.1 Gene:wnt8b / 30144 ZFINID:ZDB-GENE-990415-279 Length:358 Species:Danio rerio


Alignment Length:307 Identity:85/307 - (27%)
Similarity:138/307 - (44%) Gaps:36/307 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 QAPLSWEDITGKGLKQALDSCQQSFQWQRWNCPSQDFVQKNSKPEENSPNREDVYVAAISMAAIV 95
            :|.|.:......|.:..::.|:..|.|.||.||.: .:|.::.....|.|||..:..|||.|.::
Zfish    35 KAYLIYSSSVAAGAQSGIEECKYQFAWDRWKCPER-ALQLSTHSGLRSANRETAFFHAISSAGVM 98

  Fly    96 HTLTKDCANGVIAGCGC--TENAL-------------NVPCAHEPTKALEQYEKHFGSGSGAIG- 144
            :|||::|:.|....|||  |.|..             ||......:|   |:.....:|..|.. 
Zfish    99 YTLTRNCSLGDFDNCGCDDTRNGQRGGQGWLWGGCSDNVGFGEVISK---QFVDALETGQDARAA 160

  Fly   145 ---HNRRVVGALLQRSLEQECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQMYDDAIQ---L 203
               ||..|....::.::::.|:|.   .|.|.|..:.|...|..|..:...|.:.|..|::   |
Zfish   161 MNLHNNEVGRKAVKGTMQRTCKCH---GVSGSCTTQTCWLQLPEFREVGNYLKEKYHRAVKVDLL 222

  Fly   204 EGASSN------LKIMWQNIPLDSLVFMQDSPNYCERDATGLWKGTRGRQCSKDGSG-SLEERLS 261
            .||.::      :...:.:|....||.::|||:||..:.|....||.||:|.:.|.. |..|:.:
Zfish   223 RGAGNSAASRGAIAETFNSISRKELVHLEDSPDYCLENRTLGLPGTEGRECLRKGKNLSKWEKRT 287

  Fly   262 CQQLCRVCGYRVRSQHVRTERRCNCKLVWGFRLQCDVCVQLERQYSC 308
            |::||..||..|..:...|...||||..|...::|:.|.:...:|.|
Zfish   288 CKRLCGDCGLAVEERRAETVSSCNCKFHWCCAVKCEQCRKTVTKYYC 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wntDNP_650272.1 wnt 41..308 CDD:302926 82/295 (28%)
wnt8bNP_571034.1 WNT1 22..334 CDD:128408 84/305 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D278331at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12027
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.