DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wntD and wnt8a

DIOPT Version :9

Sequence 1:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_571021.3 Gene:wnt8a / 30122 ZFINID:ZDB-GENE-980526-332 Length:359 Species:Danio rerio


Alignment Length:318 Identity:91/318 - (28%)
Similarity:144/318 - (45%) Gaps:44/318 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PMSYYQYT-QFQAPLSWEDITGKGLKQALDSCQQSFQWQRWNCPSQDFVQKNSKPEENSPNREDV 84
            |.:|..|| ..||          |.:..::.|:..|.|.||||| :..:|.::.....|..||..
Zfish    34 PKAYLAYTSSVQA----------GAQSGIEECKHQFAWDRWNCP-ESALQLSTHKGLRSATRETA 87

  Fly    85 YVAAISMAAIVHTLTKDCANGVIAGCGCTENAL---------------NVPCAHEPTKA-LEQYE 133
            :|.|||.|.:::||||:|:.|....|||.::.:               ||.......|. ::..|
Zfish    88 FVHAISAAGVMYTLTKNCSMGDFENCGCDDSKIGKMGGRGWVWGGCSDNVNFGDRIAKLFVDALE 152

  Fly   134 KHFGSGSGAIGHNRRVVGALLQRSLEQECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQMYD 198
            ....|.:....||.......::.:|::.|:|.   .:.|.|..:.|...|..|..|...|...:|
Zfish   153 NGHDSRAAVNLHNNEAGRLAVKATLKRTCKCH---GLSGSCSIQTCWMQLADFRDIGSYLKIKHD 214

  Fly   199 DAIQLE--------GASSN----LKIMWQNIPLDSLVFMQDSPNYCERDATGLWKGTRGRQCSKD 251
            .|.:||        |.|::    :...:..:....|:||:|||:||.::.:....||.||:|.:.
Zfish   215 QARKLEMDKIRMRAGNSADNRGAIADTFSAVARTELIFMEDSPDYCVKNLSMGLHGTEGRECLQS 279

  Fly   252 GSG-SLEERLSCQQLCRVCGYRVRSQHVRTERRCNCKLVWGFRLQCDVCVQLERQYSC 308
            |.. |..||.||::||..||.:|..:.:.|...||||..|...::|:.|.|...:|.|
Zfish   280 GKNLSQWERRSCRRLCHECGLKVEERRIETVSSCNCKFHWCCTVKCETCTQTVTRYFC 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wntDNP_650272.1 wnt 41..308 CDD:302926 84/295 (28%)
wnt8aNP_571021.3 WNT1 22..337 CDD:128408 90/316 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48513
OrthoDB 1 1.010 - - D278331at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12027
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.980

Return to query results.
Submit another query.