DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wntD and Wnt8b

DIOPT Version :9

Sequence 1:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster
Sequence 2:XP_006231504.1 Gene:Wnt8b / 293990 RGDID:1307644 Length:368 Species:Rattus norvegicus


Alignment Length:318 Identity:90/318 - (28%)
Similarity:144/318 - (45%) Gaps:47/318 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PMSYYQYTQFQAPLSWEDITGKGLKQALDSCQQSFQWQRWNCPSQDFVQKNSKPEENSPNREDVY 85
            |.:|..|:...|         .|.:..::.|:..|.|.|||||.: .:|.:|.....|.|||..:
  Rat    50 PKAYLVYSSSVA---------AGAQSGIEECKYQFAWDRWNCPER-ALQLSSHGGLRSANRETAF 104

  Fly    86 VAAISMAAIVHTLTKDCANGVIAGCGCTEN---------------ALNVPCAHEPTKALEQYEKH 135
            |.|||.|.:::|||::|:.|....|||.::               :.||......:|   |:...
  Rat   105 VHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISK---QFVDA 166

  Fly   136 FGSGSGAIG----HNRRVVGALLQRSLEQECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQM 196
            ..:|..|..    ||.......::.::::.|:|.   .|.|.|..:.|...|..|..:...|.:.
  Rat   167 LETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCH---GVSGSCTTQTCWLQLPEFREVGAHLKEK 228

  Fly   197 YDDAIQ---LEGASSN------LKIMWQNIPLDSLVFMQDSPNYC-ERDATGLWKGTRGRQCSKD 251
            |..|::   |:||.::      :...:::|....||.::|||:|| |....|| .||.||:|.:.
  Rat   229 YHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGL-LGTEGRECLRR 292

  Fly   252 GSG-SLEERLSCQQLCRVCGYRVRSQHVRTERRCNCKLVWGFRLQCDVCVQLERQYSC 308
            |.. ...||.||::||..||..|..:...|...||||..|...::|:.|.:...:|.|
  Rat   293 GRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFC 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wntDNP_650272.1 wnt 41..308 CDD:302926 85/296 (29%)
Wnt8bXP_006231504.1 WNT1 39..350 CDD:128408 89/316 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D278331at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12027
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.970

Return to query results.
Submit another query.