DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wntD and Wnt8a

DIOPT Version :9

Sequence 1:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001099625.1 Gene:Wnt8a / 291678 RGDID:1306312 Length:359 Species:Rattus norvegicus


Alignment Length:322 Identity:86/322 - (26%)
Similarity:149/322 - (46%) Gaps:52/322 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PMSYYQYTQFQAPLSWEDITGKGLKQALDSCQQSFQWQRWNCPSQDFVQKNSKPEENSPNREDVY 85
            |.:|..||...|         .|.:..::.|:..|.|:|||||...| |.::........||..:
  Rat    37 PKAYVTYTASVA---------LGAQMGMEECKFQFAWERWNCPEHAF-QFSTHTRPRGATRETSF 91

  Fly    86 VAAISMAAIVHTLTKDCANGVIAGCGCTEN---------------ALNVPCAHEPTKA-LEQYEK 134
            :.||..||:::.:||:|:.|.:..|||.|:               :.||....:.::. ::..||
  Rat    92 IHAIRSAAVMYAVTKNCSMGDLETCGCDESNNGKAGGHGWIWGGCSDNVEFGEKISRLFVDSLEK 156

  Fly   135 HFGSGSGAIG--HNRRVVGALLQRSLEQECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQMY 197
              |..:.|:.  ||.|.....::.|:::.|:|.   .:.|.|..:.|...|..|..:...|...|
  Rat   157 --GKDARALMNLHNNRAGRLAVRASMKRTCKCH---GISGSCSIQTCWLQLADFRQMGNYLKAKY 216

  Fly   198 DDAIQLEGASSNLKI------MWQNIPLDS--------LVFMQDSPNYCERDAT-GLWKGTRGRQ 247
            |.|:::|.....|:.      .|  .|:::        |:|::.||:||.|:|: |:: ||.||:
  Rat   217 DRALKIETDKRQLRAGNRAEGRW--APIEAFLPSAEAELIFLEGSPDYCNRNASLGIY-GTEGRE 278

  Fly   248 CSKDG-SGSLEERLSCQQLCRVCGYRVRSQHVRTERRCNCKLVWGFRLQCDVCVQLERQYSC 308
            |.::. |.|..|:.||.:||..||.:|..:.......|:|...|...::|..|.::..:|.|
  Rat   279 CLQNARSASRWEQRSCGRLCTECGLQVEERRTEAVSSCDCNFQWCCTVKCGQCRRVVNRYYC 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wntDNP_650272.1 wnt 41..308 CDD:302926 80/300 (27%)
Wnt8aNP_001099625.1 WNT1 25..340 CDD:128408 85/320 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48513
OrthoDB 1 1.010 - - D278331at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12027
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.980

Return to query results.
Submit another query.