DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wntD and Wnt3

DIOPT Version :9

Sequence 1:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster
Sequence 2:XP_017452517.1 Gene:Wnt3 / 24882 RGDID:3972 Length:367 Species:Rattus norvegicus


Alignment Length:261 Identity:70/261 - (26%)
Similarity:108/261 - (41%) Gaps:49/261 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 REDVYVAAISMAAIVHTLTKDCANG--VIAGC---------------GCTENA-LNVPCAHEPTK 127
            ||..:|.||:.|.:...:|:.||.|  .|.||               ||:|:| ..|..:.|...
  Rat   122 RESAFVHAIASAGVAFAVTRSCAEGTSTICGCDSHHKGPPGEGWKWGGCSEDADFGVLVSREFAD 186

  Fly   128 ALEQYEKHFGSGSGAIGHNRRVVGALLQRSLEQECRCKQPGAVQGECQEEECVAVLKPFEAIAQD 192
            |.|...   .:.|....||.......:...:..:|:|.   .:.|.|:.:.|......|.||...
  Rat   187 ARENRP---DARSAMNKHNNEAGRTTILDHMHLKCKCH---GLSGSCEVKTCWWAQPDFRAIGDF 245

  Fly   193 LLQMYDDAIQL--------EGASSNLKIMWQ--NIPLD-SLVFMQDSPNYCE-RDATGLWKGTRG 245
            |...||.|.::        .|....|:..:.  ..|.: .||:.::|||:|| ...||.: |||.
  Rat   246 LKDKYDSASEMVVEKHRESRGWVETLRAKYALFKPPTERDLVYYENSPNFCEPNPETGSF-GTRD 309

  Fly   246 RQCSKDGSGSLEERLSCQQLCRVCGYRVRSQHVRTERR---CNCKLVWGFRLQCDVCVQLERQYS 307
            |.|:....| ::   .|..||  ||   |..:.|||:|   |:|...|...:.|..|:::...::
  Rat   310 RTCNVTSHG-ID---GCDLLC--CG---RGHNTRTEKRKEKCHCVFHWCCYVSCQECIRIYDVHT 365

  Fly   308 C 308
            |
  Rat   366 C 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wntDNP_650272.1 wnt 41..308 CDD:302926 69/259 (27%)
Wnt3XP_017452517.1 Wnt_Wnt3_Wnt3a <119..367 CDD:381709 70/261 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.