DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wntD and Wnt7a

DIOPT Version :9

Sequence 1:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_033553.2 Gene:Wnt7a / 22421 MGIID:98961 Length:349 Species:Mus musculus


Alignment Length:310 Identity:84/310 - (27%)
Similarity:128/310 - (41%) Gaps:62/310 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ITGKGLKQALDSCQQSFQWQRWNCPSQDFVQKNSKPEENSPNREDVYVAAISMAAIVHTLTKDCA 103
            :.|:|.:..||.||..|:..||||.:........| |....:||..:..||..|.:.|.:|..|.
Mouse    61 VIGEGSQMGLDECQFQFRNGRWNCSALGERTVFGK-ELKVGSREAAFTYAIIAAGVAHAITAACT 124

  Fly   104 NGVIAGCGCTENALNVPCAHEPTKALEQYEKHFG---SGSGA-----IG---------------- 144
            .|.::.|||.:....            ||.:..|   .|..|     ||                
Mouse   125 QGNLSDCGCDKEKQG------------QYHRDEGWKWGGCSADIRYGIGFAKVFVDAREIKQNAR 177

  Fly   145 -----HNRRVVGALLQRSLEQECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQMYDDAIQLE 204
                 ||......:|:.:::.||:|.   .|.|.|..:.|...|..|..:...|...|::|:.:|
Mouse   178 TLMNLHNNEAGRKILEENMKLECKCH---GVSGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVE 239

  Fly   205 --GASSNLKIMWQNI--------PLDS-LVFMQDSPNYCERDATGLWKGTRGRQCSKDGSGSLEE 258
              .||.|.:..:..|        |:|: ||:::.||||||.|......||:||.|:|    :..:
Mouse   240 PVRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNK----TAPQ 300

  Fly   259 RLSCQQLCRVCGYRVRSQHVRTERRCNCKLVWGFRLQCDVCVQLERQYSC 308
            ...|..:|...||... |:.|. .:||||..|...::|:.|.:....|:|
Mouse   301 ASGCDLMCCGRGYNTH-QYARV-WQCNCKFHWCCYVKCNTCSERTEMYTC 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wntDNP_650272.1 wnt 41..308 CDD:302926 83/306 (27%)
Wnt7aNP_033553.2 Wnt_Wnt7a 32..349 CDD:381723 84/310 (27%)
Disordered linker. /evidence=ECO:0000250|UniProtKB:O00755 238..266 6/27 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.