DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wntD and Wnt6

DIOPT Version :9

Sequence 1:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_033552.2 Gene:Wnt6 / 22420 MGIID:98960 Length:364 Species:Mus musculus


Alignment Length:312 Identity:79/312 - (25%)
Similarity:115/312 - (36%) Gaps:77/312 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KGLKQALDSCQQSFQWQRWNCPS----------QDFVQKNSKPEENSPNREDVYVAAISMAAIVH 96
            :|.:..:..||..|:::||||.|          ||.             ||..:|.||:.|...|
Mouse    66 RGARLGVRECQFQFRFRRWNCSSHSKAFGRVLQQDI-------------RETAFVFAITAAGASH 117

  Fly    97 TLTKDCANGVIAGCGC----------TENALNVPCAHEPTKALEQY----------EKHFGS--- 138
            .:|:.|:.|.:..|||          ....|..|....||.:.:..          :..||.   
Mouse   118 AVTQACSMGELLQCGCQAPRGRAPPRPSGLLGTPGPPGPTGSPDASAAWEWGGCGDDVDFGDEKS 182

  Fly   139 ----------GSGAIG-----HNRRVVGALLQRS-LEQECRCKQPGAVQGECQEEECVAVLKPFE 187
                      |.|.|.     ||.. .|.|..|| ...||:|.   .:.|.|....|...|.||.
Mouse   183 RLFMDAQHKRGRGDIRALVQLHNNE-AGRLAVRSHTRTECKCH---GLSGSCALRTCWQKLPPFR 243

  Fly   188 AIAQDLLQMYDDAIQLEGASSNLKIMWQNIPLD-----SLVFMQDSPNYCERDATGLWKGTRGRQ 247
            .:...||:.:..|.::.|.:....::.....|.     .|::..|||::|..:......|||||.
Mouse   244 EVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTGSPGTRGRA 308

  Fly   248 CSKDGSGSLEERLSCQQLCRVCGYRVRSQHVRTERRCNCKLVWGFRLQCDVC 299
            |    :.|..:...|..||  ||...|.:.|:.|..|.|:..|...:||..|
Mouse   309 C----NSSAPDLSGCDLLC--CGRGHRQESVQLEENCLCRFHWCCVVQCHRC 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wntDNP_650272.1 wnt 41..308 CDD:302926 79/312 (25%)
Wnt6NP_033552.2 Wnt_Wnt6 34..364 CDD:381712 79/312 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 140..162 4/21 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.