DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wntD and Wnt5b

DIOPT Version :9

Sequence 1:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster
Sequence 2:XP_036021918.1 Gene:Wnt5b / 22419 MGIID:98959 Length:394 Species:Mus musculus


Alignment Length:316 Identity:87/316 - (27%)
Similarity:134/316 - (42%) Gaps:59/316 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FQAPLSWEDITGKGLKQALDSCQQSFQWQRWNCPSQDFVQKNSKPEENSPNREDVYVAAISMAAI 94
            :|..:|:   .|:|.|..:..||..|:.:||||.:.|......:..:.. :||..:..|:|.|.:
Mouse   100 YQEHMSY---IGEGAKTGIRECQHQFRQRRWNCSTVDNTSVFGRVMQIG-SRETAFTYAVSAAGV 160

  Fly    95 VHTLTKDCANGVIAGCGCTENAL---------------NVPCAHEPTKAL---EQYEKHFGSGSG 141
            |:.:::.|..|.::.|||:..|.               ||...:...|..   .:.||:|..||.
Mouse   161 VNAISRACREGELSTCGCSRAARPKDLPRDWLWGGCGDNVEYGYRFAKEFVDAREREKNFAKGSE 225

  Fly   142 AIGH----------NRRVVGALLQRSLEQECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQM 196
            ..|.          .||.|    .:..:..|:|.   .|.|.|..:.|...|..|..:...|.:.
Mouse   226 EQGRALMNLQNNEAGRRAV----YKMADVACKCH---GVSGSCSLKTCWLQLAEFRKVGDRLKEK 283

  Fly   197 YDDAI--------QLEGASSNLKIMWQNIPLDSLVFMQDSPNYCERDATGLWKGTRGRQCSKDGS 253
            ||.|.        :||.|:|...   |..|.| ||::..||:||.|:.|....||:||.|:|...
Mouse   284 YDSAAAMRITRQGKLELANSRFN---QPTPED-LVYVDPSPDYCLRNETTGSLGTQGRLCNKTSE 344

  Fly   254 GSLEERLSCQQLCRVCGY-RVRSQHVRTERRCNCKLVWGFRLQCDVCVQLERQYSC 308
            |    ...|:.:|...|| |.:|..|   .||:|:..|...::|..|.::..||.|
Mouse   345 G----MDGCELMCCGRGYDRFKSVQV---ERCHCRFHWCCFVRCKKCTEVVDQYVC 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wntDNP_650272.1 wnt 41..308 CDD:302926 84/303 (28%)
Wnt5bXP_036021918.1 Wnt_Wnt5b 83..394 CDD:381722 87/316 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48513
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.