DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wntD and Wnt5a

DIOPT Version :9

Sequence 1:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster
Sequence 2:XP_006518986.1 Gene:Wnt5a / 22418 MGIID:98958 Length:393 Species:Mus musculus


Alignment Length:298 Identity:80/298 - (26%)
Similarity:131/298 - (43%) Gaps:42/298 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 GKGLKQALDSCQQSFQWQRWNCPSQDFVQKNSKPEENSPNREDVYVAAISMAAIVHTLTKDCANG 105
            |:|.|..:..||..|:.:||||.:.|......:..:.. :||..:..|:|.|.:|:.:::.|..|
Mouse   107 GEGAKTGIKECQYQFRHRRWNCSTVDNTSVFGRVMQIG-SRETAFTYAVSAAGVVNAMSRACREG 170

  Fly   106 VIAGCGCTENA--LNVP-------C----------AHEPTKALEQYEKHFGSGSGAIG------H 145
            .::.|||:..|  .::|       |          |.|...|.|: |:....||....      |
Mouse   171 ELSTCGCSRAARPKDLPRDWLWGGCGDNIDYGYRFAKEFVDARER-ERIHAKGSYESARILMNLH 234

  Fly   146 NRRVVGALLQRSLEQECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQMYDDAIQLEGASSNL 210
            |.......:....:..|:|.   .|.|.|..:.|...|..|..:...|.:.||.|..:. .:|..
Mouse   235 NNEAGRRTVYNLADVACKCH---GVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMR-LNSRG 295

  Fly   211 KIMWQNIPLDS-----LVFMQDSPNYCERDATGLWKGTRGRQCSKDGSGSLEERLSCQQLCRVCG 270
            |::..|...:|     ||::..||:||.|:.:....||:||.|:|...|    ...|:.:|...|
Mouse   296 KLVQVNSRFNSPTTQDLVYIDPSPDYCVRNESTGSLGTQGRLCNKTSEG----MDGCELMCCGRG 356

  Fly   271 YRVRSQHVRTERRCNCKLVWGFRLQCDVCVQLERQYSC 308
            |. :.:.|:|| ||:||..|...::|..|.::..|:.|
Mouse   357 YD-QFKTVQTE-RCHCKFHWCCYVKCKKCTEIVDQFVC 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wntDNP_650272.1 wnt 41..308 CDD:302926 79/296 (27%)
Wnt5aXP_006518986.1 Wnt_Wnt5a 82..393 CDD:381721 80/298 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48513
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.