DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wntD and Wnt3a

DIOPT Version :9

Sequence 1:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_033548.1 Gene:Wnt3a / 22416 MGIID:98956 Length:352 Species:Mus musculus


Alignment Length:297 Identity:76/297 - (25%)
Similarity:121/297 - (40%) Gaps:43/297 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KGLKQALDSCQQSFQWQRWNCPSQDFVQKNSKPEENSPNREDVYVAAISMAAIVHTLTKDCANGV 106
            :|:|..:..||..|:.:||||.:.........|..:...||..:|.||:.|.:...:|:.||.|.
Mouse    68 EGVKAGIQECQHQFRGRRWNCTTVSNSLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGS 132

  Fly   107 IAGCGCTENALNVP--------CAHE-------PTKALEQYEKHFGSGSGAIGHNRRVVGALLQR 156
            .|.|||:......|        |:.:       ..:..:..|....:.|....||.......:..
Mouse   133 AAICGCSSRLQGSPGEGWKWGGCSEDIEFGGMVSREFADARENRPDARSAMNRHNNEAGRQAIAS 197

  Fly   157 SLEQECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQMYDDAIQL--------EGASSNL--K 211
            .:..:|:|.   .:.|.|:.:.|......|..|...|...||.|.::        .|....|  :
Mouse   198 HMHLKCKCH---GLSGSCEVKTCWWSQPDFRTIGDFLKDKYDSASEMVVEKHRESRGWVETLRPR 259

  Fly   212 IMWQNIPLD-SLVFMQDSPNYCE-RDATGLWKGTRGRQCSKDGSGSLEERLSCQQLCRVCGYRVR 274
            ..:..:|.: .||:.:.|||:|| ...||.: |||.|.|:....| ::   .|..||  ||   |
Mouse   260 YTYFKVPTERDLVYYEASPNFCEPNPETGSF-GTRDRTCNVSSHG-ID---GCDLLC--CG---R 314

  Fly   275 SQHVRTERR---CNCKLVWGFRLQCDVCVQLERQYSC 308
            ..:.|||||   |:|...|...:.|..|.::...::|
Mouse   315 GHNARTERRREKCHCVFHWCCYVSCQECTRVYDVHTC 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wntDNP_650272.1 wnt 41..308 CDD:302926 75/295 (25%)
Wnt3aNP_033548.1 Wnt_Wnt3_Wnt3a 39..352 CDD:381709 76/297 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.