DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wntD and Wnt9b

DIOPT Version :9

Sequence 1:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_035849.3 Gene:Wnt9b / 22412 MGIID:1197020 Length:359 Species:Mus musculus


Alignment Length:299 Identity:82/299 - (27%)
Similarity:120/299 - (40%) Gaps:73/299 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 CQQSFQWQRWNCPSQ---DFVQKNSKPEENSPNREDVYVAAISMAAIVHTLTKDCANGVIAGCGC 112
            ||..|:.:||||..:   ..:|:..|        |..::.|:|.||:.|.|.:.|:.|.:..|.|
Mouse    91 CQFQFRQERWNCSLEGRTGLLQRGFK--------ETAFLYAVSAAALTHALARACSAGRMERCTC 147

  Fly   113 TENALNVP------------CAHE---PTKALEQYEKHFGSGSG-------AIGHNRRVVGALLQ 155
            .::    |            |...   .||.|..:   .|...|       |..||..|....::
Mouse   148 DDS----PGLESRQAWQWGVCGDNLKYSTKFLSNF---LGPKRGSKDLRARADAHNTHVGIKAVK 205

  Fly   156 RSLEQECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQMYDDAIQLEGASS----NLKIMWQN 216
            ..|...|:|.   .|.|.|....|...|.||....|.|...||.|:::..|::    .|: :|..
Mouse   206 SGLRTTCKCH---GVSGSCAVRTCWKQLSPFRETGQVLKLRYDTAVKVSSATNEALGRLE-LWAP 266

  Fly   217 I------------PLDSLVFMQDSPNYCERDATGLWKGTRGRQCSKDGSGSLEERLSCQQLCRVC 269
            .            |.| ||:|:|||::|......  .||.||.||:|.        ||..||...
Mouse   267 AKPGGPAKGLAPRPGD-LVYMEDSPSFCRPSKYS--PGTAGRVCSRDS--------SCSSLCCGR 320

  Fly   270 GYRVRSQHVRTERRCNCKLVWGFRLQCDVCVQLERQYSC 308
            ||..:|:.|...  |:|::.|...::|..|.|.|..|:|
Mouse   321 GYDTQSRMVVFS--CHCQVQWCCYVECQQCAQQELVYTC 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wntDNP_650272.1 wnt 41..308 CDD:302926 81/297 (27%)
Wnt9bNP_035849.3 wnt 62..358 CDD:278536 82/299 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.