DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wntD and Wnt1

DIOPT Version :9

Sequence 1:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_067254.1 Gene:Wnt1 / 22408 MGIID:98953 Length:370 Species:Mus musculus


Alignment Length:354 Identity:90/354 - (25%)
Similarity:134/354 - (37%) Gaps:91/354 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TSTLAAVLEP----MSYYQYTQF-QAPLSWEDITGKGLKQALDSCQQSFQWQRWNCPSQDFVQKN 71
            :.:|..||||    :|..|.... |.|.....::| ||:.|:..|:..|:.:|||||:.......
Mouse    50 SKSLQLVLEPSLQLLSRKQRRLIRQNPGILHSVSG-GLQSAVRECKWQFRNRRWNCPTAPGPHLF 113

  Fly    72 SKPEENSPNREDVYVAAISMAAIVHTLTKDCANGVIAGC-----------------GCTENALNV 119
            .| ..|...||..::.||:.|.:.|::.:.|:.|.|..|                 ||::|.   
Mouse   114 GK-IVNRGCRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNI--- 174

  Fly   120 PCAHEPTKALEQYEKHFGS---GSGAIG---------HNRRVVGALLQRSLEQECRCKQPGAVQG 172
                       .:.:.||.   .||..|         ||.......:...:.|||:|.   .:.|
Mouse   175 -----------DFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCH---GMSG 225

  Fly   173 ECQEEECVAVLKPFEAIAQDLLQMYDDAIQLEGASSNLKIMWQN--------------IPLD--- 220
            .|....|...|....|:...|...:|      |||   ::::.|              .|.|   
Mouse   226 SCTVRTCWMRLPTLRAVGDVLRDRFD------GAS---RVLYGNRGSNRASRAELLRLEPEDPAH 281

  Fly   221 ------SLVFMQDSPNYCERDATGLWKGTRGRQCSKDGSGSLEERLSCQQLCRVCGYRVRSQHVR 279
                  .||:.:.|||:|.........||.||.|: ..|.:|:   .|:.||...|:|.|:|.| 
Mouse   282 KPPSPHDLVYFEKSPNFCTYSGRLGTAGTAGRACN-SSSPALD---GCELLCCGRGHRTRTQRV- 341

  Fly   280 TERRCNCKLVWGFRLQCDVCVQLERQYSC 308
            || ||||...|...:.|..|......:.|
Mouse   342 TE-RCNCTFHWCCHVSCRNCTHTRVLHEC 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wntDNP_650272.1 wnt 41..308 CDD:302926 80/318 (25%)
Wnt1NP_067254.1 WNT1 60..370 CDD:128408 85/344 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48513
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.