DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wntD and Wnt8a

DIOPT Version :9

Sequence 1:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_033316.2 Gene:Wnt8a / 20890 MGIID:107924 Length:354 Species:Mus musculus


Alignment Length:322 Identity:86/322 - (26%)
Similarity:147/322 - (45%) Gaps:46/322 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VLEPMSYYQYTQFQAPLSWEDITGKGLKQALDSCQQSFQWQRWNCPSQDFVQKNSKPEENSPNRE 82
            :..|.:|..||...|         .|.:..::.|:..|.|:|||||...| |.::.....:..||
Mouse    30 ITRPKAYLTYTASVA---------LGAQIGIEECKFQFAWERWNCPEHAF-QFSTHNRLRAATRE 84

  Fly    83 DVYVAAISMAAIVHTLTKDCANGVIAGCGCTEN---------------ALNVPCAHEPTKA-LEQ 131
            ..::.||..|||::.:||:|:.|.:..|||.|:               :.||....:.::. ::.
Mouse    85 TSFIHAIRSAAIMYAVTKNCSMGDLENCGCDESQNGKTGGHGWIWGGCSDNVEFGEKISRLFVDS 149

  Fly   132 YEKHFGSGSGAIG--HNRRVVGALLQRSLEQECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLL 194
            .||  |..:.|:.  ||.|.....::.|.::.|:|.   .:.|.|..:.|...|..|..:...|.
Mouse   150 LEK--GKDARALVNLHNNRAGRLAVRASTKRTCKCH---GISGSCSIQTCWLQLADFRQMGNYLK 209

  Fly   195 QMYDDAIQLE------GASSNLKIMW----QNIPLD--SLVFMQDSPNYCERDATGLWKGTRGRQ 247
            ..||.|:::|      .|.:..:..|    ..:|..  .|:|::.||:||.|:|:...:||.||:
Mouse   210 AKYDRALKIEMDKRQLRAGNRAEGRWALTEAFLPSTEAELIFLEGSPDYCNRNASLSIQGTEGRE 274

  Fly   248 CSKDG-SGSLEERLSCQQLCRVCGYRVRSQHVRTERRCNCKLVWGFRLQCDVCVQLERQYSC 308
            |.::. |.|..|:.||.:||..||.:|..:.......|:|...|...::|..|.::..:|.|
Mouse   275 CLQNARSASRREQRSCGRLCTECGLQVEERRAEAVSSCDCNFQWCCTVKCGQCRRVVSRYYC 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wntDNP_650272.1 wnt 41..308 CDD:302926 80/297 (27%)
Wnt8aNP_033316.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48513
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12027
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.970

Return to query results.
Submit another query.