DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wntD and mom-2

DIOPT Version :9

Sequence 1:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_505154.1 Gene:mom-2 / 179217 WormBaseID:WBGene00003395 Length:362 Species:Caenorhabditis elegans


Alignment Length:321 Identity:83/321 - (25%)
Similarity:131/321 - (40%) Gaps:89/321 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GLKQALDSCQQSFQWQRWNC----PSQDFVQKNSKPEENSP----NREDVYVAAISMAAIVHTLT 99
            ||:.||.:|:.:||.:.|||    |...          .||    :||..||.|||.|.:.|:|.
 Worm    72 GLRSALHTCEYTFQREAWNCTLTLPGVG----------TSPLQIASRESAYVYAISAAGVSHSLA 126

  Fly   100 KDCANGVIAGCGCTEN-------ALNVPCAHEPT-------------------KALEQYEKHFGS 138
            :.|:.|:|..|||.|.       |::...:...:                   |.::||::...:
 Worm   127 RACSKGLIDDCGCGETPQGSGSVAVSQASSRSSSDFVWAGCSDNVKFGNTFGRKFVDQYDRQHAT 191

  Fly   139 --GSGAIGHNRRVVGALLQRSLEQECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQMY---- 197
              .|....||.||...||..::.:||:|.   .|.|.|..:.|..|:..|:..|..|.|.|    
 Worm   192 EPRSQMNLHNNRVGRRLLVNAMNKECKCH---GVSGSCVTKTCWKVMPKFDEFASRLHQKYQLAK 253

  Fly   198 -----DDAIQLE-----GASSNLKIMWQNIPLDS------LVFMQDSPNYCERDATGLWKGTRGR 246
                 |..:.:.     |:|...:...:|:...|      |:::..|||||..|       .:.|
 Worm   254 LVTNNDQKLTVRSSPSAGSSGRSERFARNMDASSKQMRNELIYLDASPNYCAID-------VKDR 311

  Fly   247 QCSKDGSGSLEERLSCQQLCRVCGYRVRSQHVRTERRCNCKLVWGFRLQCDVCVQL-ERQY 306
            :|.:          :|..:|  ||...|:.....:..|:|:.||...::|..|.:| ||.|
 Worm   312 ECGE----------NCPNIC--CGRGWRTTREIVDEPCHCQFVWCCEVKCKTCKKLVERNY 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wntDNP_650272.1 wnt 41..308 CDD:302926 83/321 (26%)
mom-2NP_505154.1 wnt 51..361 CDD:278536 83/321 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.