DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wntD and cwn-2

DIOPT Version :9

Sequence 1:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_501822.1 Gene:cwn-2 / 177870 WormBaseID:WBGene00000858 Length:360 Species:Caenorhabditis elegans


Alignment Length:297 Identity:83/297 - (27%)
Similarity:124/297 - (41%) Gaps:58/297 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GLKQALDSCQQSFQWQRWNCPSQDFVQKNSKPEENSPNREDVYVAAISMAAIVHTLTKDCANGVI 107
            |.:.|:..||:.|...|||| |..:......|......||..:..||..|.:.|.:.:.|..|::
 Worm    72 GAQNAIQECQRQFTGHRWNC-STHYSTGMLGPIHKMATREAAFTYAILSAGVTHEIGRRCKQGLL 135

  Fly   108 AGCGCTENA--LNVP-------CA--------------------HEPTKALEQYEKHFGSGSGAI 143
            ..|||::..  .|||       |.                    |:|       :::..:|...:
 Worm   136 TSCGCSDETKPKNVPTDWSWGGCGDNVEYGYKFSRDFIDIREKEHDP-------KRNHDNGRSLM 193

  Fly   144 GHNRRVVG-ALLQRSLEQECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQMYDDAIQLE-GA 206
            .......| .:|:|..:.:|:|.   .|.|.|..:.|...|...|.:.:.|...||.||::: ..
 Worm   194 NRRNNEAGRKILKRHRKPKCKCH---GVSGACNMKTCWMQLPSMEQVGKILRNKYDKAIRVQIND 255

  Fly   207 SSNLKIM---------WQNIPLDSLVFMQDSPNYCERDATGLWKGTRGRQCSKDGSGSLEERLSC 262
            ..||:::         .:.:|.| ||||.|||:||..|......||.||.| |.|||..|   .|
 Worm   256 RGNLQLLADEATKERKTRALPTD-LVFMDDSPDYCRFDRHSGTLGTEGRVC-KRGSGGAE---GC 315

  Fly   263 QQLCRVCGYRVRSQHVRTERRCNCKLVWGFRLQCDVC 299
            ..||...||...:|.|::  :||||..|..::.|..|
 Worm   316 DSLCCGRGYNTYTQEVKS--KCNCKFEWCCKVVCQTC 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wntDNP_650272.1 wnt 41..308 CDD:302926 83/297 (28%)
cwn-2NP_501822.1 wnt 51..360 CDD:278536 83/297 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48513
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.