DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wntD and cwn-1

DIOPT Version :9

Sequence 1:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_493668.1 Gene:cwn-1 / 173399 WormBaseID:WBGene00000857 Length:372 Species:Caenorhabditis elegans


Alignment Length:313 Identity:85/313 - (27%)
Similarity:134/313 - (42%) Gaps:73/313 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 CQQSFQWQRWNCPSQDFVQKNSKPE----ENSPNREDVYVAAISMAAIVHTLTKDCANGVIAGCG 111
            ||..|..:||||...|.|.....|:    ||:  ||..:|.|||.||:.:.:|:|||.|:...||
 Worm    77 CQFQFHKRRWNCTLIDPVTHEVIPDVFLYENT--RESAFVHAISSAAVAYKVTRDCARGISERCG 139

  Fly   112 C--TENALNVPCAHEPTKALEQYE-------------KHF-------------GSGSGAIG---- 144
            |  ::|       ....|:..||:             |.|             .:|:..:|    
 Worm   140 CDYSKN-------DHSGKSQFQYQGCSDNVKFGIGVSKEFVDSAQRRVLMMKDDNGTSLLGPSQL 197

  Fly   145 ----------HNRRVVGALLQRSLEQECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQMYDD 199
                      ||.:....:|::||.:||:|.   .:.|.|:...|...|..|..|...:...:|.
 Worm   198 SADGMHMINLHNNQAGRQVLEKSLRRECKCH---GMSGSCEMRTCWDSLPNFRHIGMAIKDKFDG 259

  Fly   200 AIQL----EGASSNLKIMWQNIPLD-----SLVFMQDSPNYCERDATGLWKGTRGRQCSKDGSGS 255
            |.::    |......:|:.:|....     .||:|..||::||.|......||:||||:. ...:
 Worm   260 AAEVKVVKEDGIEKPRIVMKNSQFKRHTNADLVYMTPSPDFCESDPLRGILGTKGRQCTL-APNA 323

  Fly   256 LEERLSCQQLCRVCGYRVRSQHVRTERRCNCKLVWGFRLQCDVCVQLERQYSC 308
            :::   |..||...||..:.|.|  |.:||||.::...::|:.|.:...:|.|
 Worm   324 IDD---CSLLCCGRGYEKKVQIV--EEKCNCKFIYCCEVRCEPCQKRIEKYLC 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wntDNP_650272.1 wnt 41..308 CDD:302926 84/311 (27%)
cwn-1NP_493668.1 WNT1 44..372 CDD:128408 85/313 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48513
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.