DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wntD and Wnt2b

DIOPT Version :9

Sequence 1:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001178777.1 Gene:Wnt2b / 116466 RGDID:69346 Length:391 Species:Rattus norvegicus


Alignment Length:298 Identity:77/298 - (25%)
Similarity:123/298 - (41%) Gaps:45/298 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 GKGLKQALDSCQQSFQWQRWNCPSQDFVQKNSKPEENSPNREDVYVAAISMAAIVHTLTKDCANG 105
            |:|.::.:..||..|:..||||.:.|.............:||..:|.|||.|.:||.:|:.|:.|
  Rat    97 GEGAREWIRECQHQFRHHRWNCTTLDRDHTVFGRAMLRSSREAAFVYAISSAGVVHAITRACSQG 161

  Fly   106 VIAGC--------------------GCTENALNVPCAHEPTKALEQY----EKHFGSGSGAIG-H 145
            .::.|                    ||::|      .|...:..:.:    ||........:. |
  Rat   162 ELSVCSCDPYTRGRHHDQRGDFDWGGCSDN------IHYGVRFAKAFVDAKEKRLKDARALMNLH 220

  Fly   146 NRRVVGALLQRSLEQECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQMYDDAIQL----EGA 206
            |.|.....::|.|:.||:|.   .|.|.|....|...|..|......|.:.||.|:|:    :||
  Rat   221 NNRCGRTAVRRFLKLECKCH---GVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVTATQDGA 282

  Fly   207 S-SNLKIMWQNIPLDSLVFMQDSPNYCERDATGLWKGTRGRQCSKDGSGSLEERLSCQQLCRVCG 270
            : :..:..:::.....||:..:||:||..|......||.||.|||...|:    ..|:.:|  ||
  Rat   283 NFTAARQGYRHATRTDLVYFDNSPDYCVLDKAAGSLGTAGRVCSKTSKGT----DGCEIMC--CG 341

  Fly   271 YRVRSQHVRTERRCNCKLVWGFRLQCDVCVQLERQYSC 308
            ....:..|....:|.||..|...::|..|......::|
  Rat   342 RGYDTTRVTRVTQCECKFHWCCAVRCKECRNTVDVHTC 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wntDNP_650272.1 wnt 41..308 CDD:302926 76/296 (26%)
Wnt2bNP_001178777.1 wnt 78..380 CDD:278536 77/298 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.