DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wntD and wnt1

DIOPT Version :9

Sequence 1:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster
Sequence 2:XP_002935152.1 Gene:wnt1 / 100491444 XenbaseID:XB-GENE-485280 Length:372 Species:Xenopus tropicalis


Alignment Length:327 Identity:83/327 - (25%)
Similarity:124/327 - (37%) Gaps:79/327 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 QAPLSWEDITGKGLKQALDSCQQSFQWQRWNCPSQDFVQKNSKPEENSPNREDVYVAAISMAAIV 95
            |.|...:.|| :||..|:..|:..|:.:|||||:....|...| ..|...||..:|.||:.|.:.
 Frog    75 QNPGILQSIT-RGLHSAIRECKWQFRNRRWNCPTGTGNQVFGK-IINRGCRETAFVFAITSAGVT 137

  Fly    96 HTLTKDCANGVIAGCGCTENALNVPCAHEPTKALEQYEK--------HFGSGSGAIG-------- 144
            |::.:.|:.|.|..|.|                  .|.:        |:|..|..|.        
 Frog   138 HSVARSCSEGSIESCSC------------------DYRRRGPGGPDWHWGGCSDNIEFGRFIGRE 184

  Fly   145 -----------------HNRRVVGALLQRSLEQECRCKQPGAVQGECQEEECVAVLKPFEAIAQD 192
                             ||.:.....:...:.|||:|.   .:.|.|....|...|.||.::...
 Frog   185 FVDSSERGRDLKYLVNLHNNQAGRLTVLTEMRQECKCH---GMSGSCSLRTCWMRLPPFRSVGDA 246

  Fly   193 LLQMYDDAIQLEGASSNLKIMWQN---------------IP-LDSLVFMQDSPNYCERDATGLWK 241
            |...:|.|.::. .|:|....|.:               :| ...||:.:.|||:|.........
 Frog   247 LKDRFDGASKVT-YSNNGSNRWGSRSDPPHLEPENPTHALPSSQDLVYFEKSPNFCSASEKNGTP 310

  Fly   242 GTRGRQCSKDGSGSLEERLSCQQLCRVCGYRVRSQHVRTERRCNCKLVWGFRLQCDVCVQLERQY 306
            ||.||.|:....| |:   .|:.||...|||.|::.| || ||:|...|...:.|..|...:..:
 Frog   311 GTTGRICNSTSLG-LD---GCELLCCGRGYRSRAEKV-TE-RCHCTFHWCCHVTCLNCTSSQIVH 369

  Fly   307 SC 308
            .|
 Frog   370 EC 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wntDNP_650272.1 wnt 41..308 CDD:302926 78/315 (25%)
wnt1XP_002935152.1 Wnt_Wnt1 65..372 CDD:381707 83/327 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48513
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.