DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wntD and wnt3a

DIOPT Version :9

Sequence 1:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster
Sequence 2:XP_002939354.2 Gene:wnt3a / 100488632 XenbaseID:XB-GENE-1217288 Length:352 Species:Xenopus tropicalis


Alignment Length:300 Identity:76/300 - (25%)
Similarity:121/300 - (40%) Gaps:49/300 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KGLKQALDSCQQSFQWQRWNCPSQDFVQKNSK---PEENSPNREDVYVAAISMAAIVHTLTKDCA 103
            :|:|..:..||..|:.:||||.:   |..|..   |..:...||..:|.||:.|.:...:|:.||
 Frog    68 EGVKIGIQECQHQFRGRRWNCTT---VNDNLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSCA 129

  Fly   104 NGVIAGCGCTENALNVP--------CAHE-------PTKALEQYEKHFGSGSGAIGHNRRVVGAL 153
            .|....|||..:....|        |:.:       ..:..:..|....:.|....||.......
 Frog   130 EGSATICGCDSHHKGPPGEGWKWGGCSEDMDFGSMVSREFADARENRPDARSAMNRHNNEAGRTS 194

  Fly   154 LQRSLEQECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQMYDDAIQL--------EGASSNL 210
            :......:|:|.   .:.|.|:.:.|......|..|...|...||.|.::        .|....|
 Frog   195 ILDHRHLKCKCH---GLSGSCEVKTCWWSQPDFRVIGDYLKDKYDSASEMVVEKHRESRGWVETL 256

  Fly   211 --KIMWQNIPLD-SLVFMQDSPNYCE-RDATGLWKGTRGRQCSKDGSGSLEERLSCQQLCRVCGY 271
              |..:...|.: .|::.:.|||:|| ...||.: |||.|.|:....| ::   .|..||  || 
 Frog   257 RPKYTFFKPPTERDLIYYESSPNFCEPNPETGSF-GTRDRVCNVTSHG-ID---GCDLLC--CG- 313

  Fly   272 RVRSQHVRTERR---CNCKLVWGFRLQCDVCVQLERQYSC 308
              |..:.|||:|   |:|...|...:.|..|:::...::|
 Frog   314 --RGHNTRTEKRKEKCHCIFHWCCYVSCQECIRVYDVHTC 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wntDNP_650272.1 wnt 41..308 CDD:302926 75/298 (25%)
wnt3aXP_002939354.2 Wnt_Wnt3_Wnt3a 39..352 CDD:381709 75/299 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.