DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wntD and wnt7b

DIOPT Version :9

Sequence 1:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001120105.1 Gene:wnt7b / 100145124 XenbaseID:XB-GENE-481936 Length:282 Species:Xenopus tropicalis


Alignment Length:309 Identity:84/309 - (27%)
Similarity:129/309 - (41%) Gaps:78/309 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LDSCQQSFQWQRWNCPSQD----FVQKNSKPEENSPNREDVYVAAISMAAIVHTLTKDCANGVIA 108
            ::.||..|::.||||.:..    |.|     |....:||..:..||:.|.:.|.:|..|:.|.::
 Frog     3 INECQYQFRYGRWNCSALGERTVFGQ-----ELRVGSREAAFTYAITAAGVAHAVTSACSQGNLS 62

  Fly   109 GCGCTENALNVPCAHEPTKALEQYEKHFGSGSGA-----IGHNRRVVGA---------------- 152
            .|||.         .|......|.|.....|..|     |..:|:.|.|                
 Frog    63 NCGCD---------REKQGYYNQEEGWKWGGCSADIKYGIDFSRKFVDAREIKKNARRLMNLHNN 118

  Fly   153 -----LLQRSLEQECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQMYDDAIQLEGASSN--- 209
                 :|:..::.||:|.   .|.|.|..:.|...|..|..|...|.:.|:||:.:|...:|   
 Frog   119 EAGRKVLEEKMKLECKCH---GVSGSCTTKTCWNTLPKFREIGFVLKEKYNDAVHVEVVRANRLR 180

  Fly   210 ----LKI----MWQNIPLDS-LVFMQDSPNYCERD-ATGLWKGTRGRQCSK-----DGSGSLEER 259
                |||    .:|. |::: ||:::.||||||.| |||. .||:||.|::     ||       
 Frog   181 QPTFLKIKKVRSYQK-PMETDLVYIERSPNYCEEDSATGS-VGTQGRLCNRTSPHTDG------- 236

  Fly   260 LSCQQLCRVCGYRVRSQHVRTERRCNCKLVWGFRLQCDVCVQLERQYSC 308
              |..:|  ||....:.......:||||..|...::|:.|.:....::|
 Frog   237 --CDLMC--CGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTC 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wntDNP_650272.1 wnt 41..308 CDD:302926 83/307 (27%)
wnt7bNP_001120105.1 Wnt 1..282 CDD:393294 84/309 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.