DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wntD and wnt9b

DIOPT Version :9

Sequence 1:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001096553.1 Gene:wnt9b / 100125200 XenbaseID:XB-GENE-866787 Length:357 Species:Xenopus tropicalis


Alignment Length:350 Identity:81/350 - (23%)
Similarity:139/350 - (39%) Gaps:72/350 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FMGITS--TLAAVLEPMSYYQYTQFQAPLSWEDI------------TGKGLKQALD--------S 50
            :.|:||  :|:....|......|..:..|...|:            ...||.:||.        .
 Frog    29 YFGLTSKESLSLFTSPAPVISSTHSRPHLKQCDLLPLTRRQRRLCRKEPGLAEALREAVRLGVVE 93

  Fly    51 CQQSFQWQRWNCPSQD---FVQKNSKPEENSPNREDVYVAAISMAAIVHTLTKDCANGVIAGCGC 112
            ||...:.:||||..|:   .:::..|        |..::.|||.|::.|:|.|.|:.|.:..|.|
 Frog    94 CQFQLRSERWNCSLQERGNLLKRGFK--------ETAFMYAISAASLTHSLAKACSGGRMERCTC 150

  Fly   113 TEN-ALNVPCA----------HEPTKALEQYEKHFGSGSGAIG----HNRRVVGALLQRSLEQEC 162
            .:: .|....|          ...|:.|:.:.:....|..|..    ||.......::..|:..|
 Frog   151 DDSQGLESQQAWQWGVCGDNLRHSTRFLQNFLRQKKGGRDARAKMDLHNSNAGIKAVKSGLKTTC 215

  Fly   163 RCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQMYDDAIQLEGASSNL---------KIMWQNIP 218
            :|.   .|.|.|....|...|.||......|...|::||::.|||:..         ....::..
 Frog   216 KCH---GVSGSCAVRTCWKQLSPFHETGALLKAKYENAIKIHGASNEAVGGHESLGHTFGGRHAR 277

  Fly   219 LDSLVFMQDSPNYCERDATGLWKGTRGRQCSKDGSGSLEERLSCQQLCRVCGYRVRSQHVRTERR 283
            ....:::::|||:|.  .:....||.||.|.::.        :|..||...||.::::.|...  
 Frog   278 STDFLYLEESPNFCR--PSRFSPGTAGRTCLREN--------TCDSLCCGRGYNIQTRMVTFS-- 330

  Fly   284 CNCKLVWGFRLQCDVCVQLERQYSC 308
            |:|::.|...::|..|||.:..|:|
 Frog   331 CHCQVHWCCHVECQKCVQQQETYTC 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wntDNP_650272.1 wnt 41..308 CDD:302926 72/301 (24%)
wnt9bNP_001096553.1 Wnt_Wnt9b 65..356 CDD:381728 72/313 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.