DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment apn and CG14960

DIOPT Version :9

Sequence 1:NP_650270.1 Gene:apn / 41631 FlyBaseID:FBgn0038132 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_647797.1 Gene:CG14960 / 38403 FlyBaseID:FBgn0035428 Length:331 Species:Drosophila melanogaster


Alignment Length:72 Identity:22/72 - (30%)
Similarity:42/72 - (58%) Gaps:2/72 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SDSDVAESRTFGHHFLRRISFALVPGAFVVGVITTLLAALTVVSIKGLGVGVILLVLAIGQMLSR 97
            |.|...|.||||.  :||:..||:|..|..||::.::|.|..:.:|.|.:..:|:|:....:|.:
  Fly   141 SGSSAVEGRTFGK--IRRLQMALIPIIFKFGVLSAMVAFLVAIGMKSLFLLKVLVVMNAIAILGK 203

  Fly    98 ALPVQAA 104
            .:.::::
  Fly   204 FITLKSS 210



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2D54T
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.