powered by:
Protein Alignment apn and CG14960
DIOPT Version :9
Sequence 1: | NP_650270.1 |
Gene: | apn / 41631 |
FlyBaseID: | FBgn0038132 |
Length: | 137 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_647797.1 |
Gene: | CG14960 / 38403 |
FlyBaseID: | FBgn0035428 |
Length: | 331 |
Species: | Drosophila melanogaster |
Alignment Length: | 72 |
Identity: | 22/72 - (30%) |
Similarity: | 42/72 - (58%) |
Gaps: | 2/72 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 33 SDSDVAESRTFGHHFLRRISFALVPGAFVVGVITTLLAALTVVSIKGLGVGVILLVLAIGQMLSR 97
|.|...|.||||. :||:..||:|..|..||::.::|.|..:.:|.|.:..:|:|:....:|.:
Fly 141 SGSSAVEGRTFGK--IRRLQMALIPIIFKFGVLSAMVAFLVAIGMKSLFLLKVLVVMNAIAILGK 203
Fly 98 ALPVQAA 104
.:.::::
Fly 204 FITLKSS 210
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_2D54T |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.