DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8630 and AT1G06360

DIOPT Version :9

Sequence 1:NP_731781.1 Gene:CG8630 / 41629 FlyBaseID:FBgn0038130 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001320561.1 Gene:AT1G06360 / 837147 AraportID:AT1G06360 Length:315 Species:Arabidopsis thaliana


Alignment Length:327 Identity:92/327 - (28%)
Similarity:146/327 - (44%) Gaps:48/327 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 TPSQKV--------AKKAEAKTPENKPY-ELEIVWRNV--GLFVI-LHSMALYGLYLVFAESAYW 91
            ||.:.:        :.|..|.:.|.:|| ..|..|.::  .|.|| :|.:.|...:     :..|
plant    12 TPQRSMCDPIREDGSNKRGAVSKEKRPYIHREWSWADIIRALTVINVHFLCLLAPF-----NYKW 71

  Fly    92 ELL----PVYATMFLGGLGITAGVHRLWSHKAYK----AKLPLRIFLMLCQSLAFQNSIWEWTRD 148
            |.|    .:||   |..|.||...||..:|:::|    .:.||..|.:    .|.|....:|...
plant    72 EALRFGFVLYA---LTSLSITFSYHRNLAHRSFKLPKWLEYPLAYFAV----FALQGDPLDWVSI 129

  Fly   149 HRVHHKFTDTHADPHNSRRGFFFAHMGWLMCKKHPDVTSKGKQISMEDIEQDPVVMFQKKMYFVV 213
            ||.||:|||:..|||:...||:|:|:.|:...::......|:. ::.|::|      |...:|:.
plant   130 HRFHHQFTDSDRDPHSPIEGFWFSHVWWICDTRYIKYKCGGRN-NVMDLKQ------QWFYWFLR 187

  Fly   214 MPICCFALPMIFPYYVMGSSLRVCFFTC-SMLRFCLSLHFTWLVNSAAHFYGMKPYDVNVSAMNN 277
            |.|....|......|:.|.   :.:.|| ..:...:..|.|||||||.|.:|.:.:....::.|.
plant   188 MTIGFHVLMFWTVLYLYGG---LPYLTCGGGVGGVIGYHVTWLVNSACHIWGSRSWKTKDTSRNV 249

  Fly   278 KLVSTLTIGEGWHNYHHVFPWDYKAAELGT--YSFNWTTAFIDVMAKIGQAYDLKFVSQEMVYKR 340
            ..:|..|:||.|||.||.|.   .:|..|.  :..:.|...|.:...:|.|.|:|..|:....|.
plant   250 WWLSLFTMGESWHNNHHAFE---SSARQGLEWWQIDITWYLIRLFEVLGLATDVKLPSEIQKQKL 311

  Fly   341 VL 342
            .|
plant   312 AL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8630NP_731781.1 Delta9-FADS-like 90..330 CDD:239582 74/250 (30%)
FA_desaturase 91..297 CDD:278890 66/214 (31%)
AT1G06360NP_001320561.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 124 1.000 Domainoid score I1803
eggNOG 1 0.900 - - E1_COG1398
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I1806
OMA 1 1.010 - - QHG63267
OrthoDB 1 1.010 - - D971318at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1155
orthoMCL 1 0.900 - - OOG6_100468
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X207
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.740

Return to query results.
Submit another query.