DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8630 and ADS4

DIOPT Version :9

Sequence 1:NP_731781.1 Gene:CG8630 / 41629 FlyBaseID:FBgn0038130 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_172124.2 Gene:ADS4 / 837146 AraportID:AT1G06350 Length:300 Species:Arabidopsis thaliana


Alignment Length:278 Identity:78/278 - (28%)
Similarity:122/278 - (43%) Gaps:26/278 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 VILHSMALYGLYLVFAESAYWELLPVYATMF-LGGLGITAGVHRLWSHKAYKAKLPLRIFLMLCQ 134
            ||:|.:.|...:     :..||.|.....:| |..|.||...||..||:::|....|........
plant    41 VIVHFLCLLAPF-----NFKWEALRFGLVLFALTTLSITFSFHRNLSHRSFKIPKWLEYPWAYSA 100

  Fly   135 SLAFQNSIWEWTRDHRVHHKFTDTHADPHNSRRGFFFAHMGWLMCKKHPDVTSKGKQISMEDIEQ 199
            ..|.|....:|...||.||:|||:..|||:.:.|..|:|:.|:...::......|:         
plant   101 VFALQGDPMDWVSIHRFHHQFTDSDRDPHSPKEGLLFSHILWIFDTQYIKYKCGGR--------- 156

  Fly   200 DPVVMFQKKMY--FVVMPICCFALPMIFPYYVMGSSLRVCFFTC-SMLRFCLSLHFTWLVNSAAH 261
            |.|:..:|:.:  |:...|....|......|:.|.   :.:.|| ..:...:..|.|||||||.|
plant   157 DNVLDLKKQWFYKFLRRTIAVHILMFWTILYLYGG---LPYLTCGGGVGIFIGYHVTWLVNSACH 218

  Fly   262 FYGMKPYDVNVSAMNNKLVSTLTIGEGWHNYHHVFPWDYKAAELGT--YSFNWTTAFIDVMAKIG 324
            .:|.:.::...::.|...:|..|:||.|||.||.|.   .:|..|.  :..:.|...|.:...:|
plant   219 IWGSRSWNTKDTSRNVWWLSLFTMGESWHNNHHAFE---SSARQGLEWWQIDITWYLIRLFEVLG 280

  Fly   325 QAYDLKFVSQEMVYKRVL 342
            .|.|:|..|:....|..|
plant   281 IATDVKLPSELQKQKMAL 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8630NP_731781.1 Delta9-FADS-like 90..330 CDD:239582 70/245 (29%)
FA_desaturase 91..297 CDD:278890 62/209 (30%)
ADS4NP_172124.2 PLN02220 1..300 CDD:177866 78/278 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 124 1.000 Domainoid score I1803
eggNOG 1 0.900 - - E1_COG1398
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I1806
OMA 1 1.010 - - QHG63267
OrthoDB 1 1.010 - - D971318at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1155
orthoMCL 1 0.900 - - OOG6_100468
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X207
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.740

Return to query results.
Submit another query.