DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8630 and AT1G06090

DIOPT Version :9

Sequence 1:NP_731781.1 Gene:CG8630 / 41629 FlyBaseID:FBgn0038130 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_172099.1 Gene:AT1G06090 / 837118 AraportID:AT1G06090 Length:299 Species:Arabidopsis thaliana


Alignment Length:257 Identity:70/257 - (27%)
Similarity:118/257 - (45%) Gaps:15/257 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 ALYGLYLVFAESAYWELLPVYATM-FLGGLGITAGVHRLWSHKAYKAKLPLRIFLMLCQSLAFQN 140
            |::.|.|:...:..||.|.....: .:..|.||...||..:||::|....|..........|.|.
plant    41 AVHLLCLLAPFNYKWEALRFGVILAIVTSLSITFSYHRNLTHKSFKLPKWLEYPFAYSALFALQG 105

  Fly   141 SIWEWTRDHRVHHKFTDTHADPHNSRRGFFFAHMGWLMCKKHPDVTSK-GKQISMEDIEQDPVVM 204
            ...:|...||.||:|||:..|||:...||:|:|:.|:....:  :..| |.:.::.|::|.....
plant   106 HPIDWVSTHRFHHQFTDSDRDPHSPIEGFWFSHVFWIFDTSY--IREKCGGRDNVMDLKQQWFYR 168

  Fly   205 FQKKMYFVVMPICCFALPMIFPYYVMGSSLRVCFFTCSM-LRFCLSLHFTWLVNSAAHFYGMKPY 268
            |.:..  :.:.|..|...:    |:.|.   :.:.||.: :...:..:.|||:|||.|.:|.:.:
plant   169 FLRNT--IGLHILTFWTLV----YLWGG---LPYLTCGVGVGGTIGYNGTWLINSACHIWGSRAW 224

  Fly   269 DVNVSAMNNKLVSTLTIGEGWHNYHHVFPWDYKAAELGTYSFNWTTAFIDVMAKIGQAYDLK 330
            :...::.|...:...|:||.|||.||.|....:.. |..|..:.|...|.....:|.|.|:|
plant   225 NTKDTSRNIWWLGPFTMGESWHNNHHAFEASARHG-LEWYQVDLTWYLICFFQALGLATDVK 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8630NP_731781.1 Delta9-FADS-like 90..330 CDD:239582 66/242 (27%)
FA_desaturase 91..297 CDD:278890 58/208 (28%)
AT1G06090NP_172099.1 PLN02220 1..299 CDD:177866 70/257 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 124 1.000 Domainoid score I1803
eggNOG 1 0.900 - - E1_COG1398
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I1806
OMA 1 1.010 - - QHG63267
OrthoDB 1 1.010 - - D971318at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1155
orthoMCL 1 0.900 - - OOG6_100468
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X207
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.740

Return to query results.
Submit another query.