DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8630 and FAD5

DIOPT Version :9

Sequence 1:NP_731781.1 Gene:CG8630 / 41629 FlyBaseID:FBgn0038130 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_566529.1 Gene:FAD5 / 820828 AraportID:AT3G15850 Length:371 Species:Arabidopsis thaliana


Alignment Length:339 Identity:99/339 - (29%)
Similarity:153/339 - (45%) Gaps:44/339 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KMAATPAASAAPS---AATPSQKVAKKAEAKTPENKPYELEIVW-------RNVGLFVILHSMAL 78
            |...|.||:|...   ....|..:.||.|           ::||       .:.|...::.||.|
plant    61 KRDVTTAAAATEGDYRRIMLSDVLVKKKE-----------KVVWWEREWKAMDFGAVAVVLSMHL 114

  Fly    79 YGLYLVFAESAYWELLPVYATMFL--GGLGITAGVHRLWSHKAYKAKLPLRIFLMLCQSLAFQNS 141
            ..|...|..:  |..:.|...:::  |.||||...||..||||:|....|......|.:.|.|.:
plant   115 LSLLAPFQFN--WRAVSVAFGLYIVTGLLGITLSFHRNLSHKAFKLPKWLEYLFAYCGAQALQGN 177

  Fly   142 IWEWTRDHRVHHKFTDTHADPHNSRRGFFFAHMGWLMCKKHPDVTSK-GKQISMEDIEQDPVVMF 205
            ..:|...||.||:|.|:..|||:...||:|:||.|:....  .:|.: |:..::.|:|:.|...|
plant   178 PIDWVSTHRYHHQFCDSDRDPHSPLDGFWFSHMNWMFDTN--TITQRCGEPNNVGDLEKQPFYRF 240

  Fly   206 QKKMYF---VVMPICCFALPMIFPYYVMGSSLRVCFFTCSMLRFCLSLHFTWLVNSAAHFYGMKP 267
            .:..|.   :.:.:..:|:.. ||:.|.|..:|:.:.          .|.|||||||.|.:|.:.
plant   241 LRTTYILHPLALAVALYAMGG-FPFIVWGMGVRIVWV----------YHITWLVNSACHVWGKQA 294

  Fly   268 YDVNVSAMNNKLVSTLTIGEGWHNYHHVFPWDYKAAELGTYSFNWTTAFIDVMAKIGQAYDLKFV 332
            ::....:.||..|:.|..||||||.||.|.:..:.. |..:..:.|...:..:..||.|.|:|..
plant   295 WNTGDLSKNNWWVAALAFGEGWHNNHHAFEFSARHG-LEWWQLDMTWYVVKFLQAIGLATDVKLP 358

  Fly   333 SQEMVYKRVLRTGD 346
            | |...:|:..|.|
plant   359 S-EAQKQRMAFTSD 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8630NP_731781.1 Delta9-FADS-like 90..330 CDD:239582 76/245 (31%)
FA_desaturase 91..297 CDD:278890 69/211 (33%)
FAD5NP_566529.1 Membrane-FADS-like 96..369 CDD:294412 86/289 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 124 1.000 Domainoid score I1803
eggNOG 1 0.900 - - E1_COG1398
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I1806
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D971318at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1155
orthoMCL 1 0.900 - - OOG6_100468
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X207
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.730

Return to query results.
Submit another query.