DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8630 and ADS2

DIOPT Version :9

Sequence 1:NP_731781.1 Gene:CG8630 / 41629 FlyBaseID:FBgn0038130 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001323798.1 Gene:ADS2 / 817694 AraportID:AT2G31360 Length:307 Species:Arabidopsis thaliana


Alignment Length:326 Identity:96/326 - (29%)
Similarity:155/326 - (47%) Gaps:40/326 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LAETAIADGNNNKMAATPAASAAPSAATPSQKVAKKAEAKTP--ENKPYELEIVWRNVGLFVILH 74
            ::.|:..:.|:.|..:||||            |.:|.:.:..  :.:...|:.|..:....|  |
plant     1 MSVTSTVEENHQKNPSTPAA------------VEEKKKRRWVFWDRRWRRLDYVKFSASFTV--H 51

  Fly    75 SMALYGLYLVFAESAYWELLPVYATMFLGGLGITAGVHRLWSHKAYKAKLPLRIFLMLCQSLAFQ 139
            |:||...: .|..||.|.....|.   :||||||...||..:|:::|....|...|..|..||.|
plant    52 SLALLAPF-YFTWSALWVTFLFYT---IGGLGITVSYHRNLAHRSFKVPKWLEYLLAYCALLAIQ 112

  Fly   140 NSIWEWTRDHRVHHKFTDTHADPHNSRRGFFFAHMGWLMCKKHPDVTSK-GKQISMEDIEQDPVV 203
            ....:|...||.||:|||:..|||:.:.||:|:|:.|:....:  :.|| |::.::||:::....
plant   113 GDPIDWVSTHRYHHQFTDSERDPHSPKEGFWFSHLLWIYDSAY--LVSKCGRRANVEDLKRQWFY 175

  Fly   204 MF-QKKMYFVVMPICCFALPMIFPYYVMGSSLRVCFFTCSM-LRFCLSLHFTWLVNSAAHFYGMK 266
            .| ||.:.|.::.:      ..|.:|:.|.|    |.|..| :...|.:|.|.|:||..|.:|.:
plant   176 RFLQKTVLFHILGL------GFFLFYLGGMS----FVTWGMGVGAALEVHVTCLINSLCHIWGTR 230

  Fly   267 PYDVNVSAMNNKLVSTLTIGEGWHNYHHVFPWDYK-AAELGTYSFNW-TTAFIDVMAKIGQAYDL 329
            .:..|.::.|...:|..:.||.|||.||.|....: ..|......:| ...|.::   ||.|.|:
plant   231 TWKTNDTSRNVWWLSVFSFGESWHNNHHAFESSARQGLEWWQIDISWYIVRFFEI---IGLATDV 292

  Fly   330 K 330
            |
plant   293 K 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8630NP_731781.1 Delta9-FADS-like 90..330 CDD:239582 76/244 (31%)
FA_desaturase 91..297 CDD:278890 68/208 (33%)
ADS2NP_001323798.1 PLN02220 1..307 CDD:177866 96/326 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 124 1.000 Domainoid score I1803
eggNOG 1 0.900 - - E1_COG1398
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I1806
OMA 1 1.010 - - QHG63267
OrthoDB 1 1.010 - - D971318at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1155
orthoMCL 1 0.900 - - OOG6_100468
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X207
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.740

Return to query results.
Submit another query.