DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8630 and SCD5

DIOPT Version :9

Sequence 1:NP_731781.1 Gene:CG8630 / 41629 FlyBaseID:FBgn0038130 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001032671.2 Gene:SCD5 / 79966 HGNCID:21088 Length:330 Species:Homo sapiens


Alignment Length:330 Identity:156/330 - (47%)
Similarity:211/330 - (63%) Gaps:18/330 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PSAATPSQKVA---KKAEAKT-------------PENKPYELEIVWRNVGLFVILHSMALYGLYL 83
            |..||.:.|:.   .|.|.:.             |..:.....||||||.|..:||..|:|.|.|
Human     2 PGPATDAGKIPFCDAKEEIRAGLESSEGGGGPERPGARGQRQNIVWRNVVLMSLLHLGAVYSLVL 66

  Fly    84 VFAESAYWELLPVYATMFLGGLGITAGVHRLWSHKAYKAKLPLRIFLMLCQSLAFQNSIWEWTRD 148
            : .::....||..|....|..||:|||.||||||::|:|||||||||.:..|:||||.|:||:||
Human    67 I-PKAKPLTLLWAYFCFLLAALGVTAGAHRLWSHRSYRAKLPLRIFLAVANSMAFQNDIFEWSRD 130

  Fly   149 HRVHHKFTDTHADPHNSRRGFFFAHMGWLMCKKHPDVTSKGKQISMEDIEQDPVVMFQKKMYFVV 213
            ||.|||:::|.|||||:||||||:|:|||..:||.||..||:::.:.|:..||||..|:|.|.:.
Human   131 HRAHHKYSETDADPHNARRGFFFSHIGWLFVRKHRDVIEKGRKLDVTDLLADPVVRIQRKYYKIS 195

  Fly   214 MPICCFALPMIFPYYVMGSSLRVCFFTCSMLRFCLSLHFTWLVNSAAHFYGMKPYDVNVSAMNNK 278
            :.:.||.:|.:.|:|:.|.||...:|..|:||:.:||:.:||||||||.||.:|||.::|...|.
Human   196 VVLMCFVVPTLVPWYIWGESLWNSYFLASILRYTISLNISWLVNSAAHMYGNRPYDKHISPRQNP 260

  Fly   279 LVSTLTIGEGWHNYHHVFPWDYKAAELGTYSFNWTTAFIDVMAKIGQAYDLKFVSQEMVYKRVLR 343
            ||:...||||:|||||.||:||.|:|.| .:||.||.|||.|..:|.|.|.|..::.|:..|..|
Human   261 LVALGAIGEGFHNYHHTFPFDYSASEFG-LNFNPTTWFIDFMCWLGLATDRKRATKPMIEARKAR 324

  Fly   344 TGDGS 348
            |||.|
Human   325 TGDSS 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8630NP_731781.1 Delta9-FADS-like 90..330 CDD:239582 128/239 (54%)
FA_desaturase 91..297 CDD:278890 110/205 (54%)
SCD5NP_001032671.2 Delta9-FADS-like 71..311 CDD:239582 128/240 (53%)
FA_desaturase 77..279 CDD:278890 108/201 (54%)
Histidine box-1. /evidence=ECO:0000305 94..99 4/4 (100%)
Histidine box-2. /evidence=ECO:0000305 131..135 2/3 (67%)
Histidine box-3. /evidence=ECO:0000305 272..276 3/3 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154901
Domainoid 1 1.000 46 1.000 Domainoid score I12114
eggNOG 1 0.900 - - E1_COG1398
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63267
OrthoDB 1 1.010 - - D296120at33208
OrthoFinder 1 1.000 - - FOG0000495
OrthoInspector 1 1.000 - - mtm8474
orthoMCL 1 0.900 - - OOG6_100468
Panther 1 1.100 - - O PTHR11351
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X207
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.720

Return to query results.
Submit another query.