DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8630 and scd

DIOPT Version :9

Sequence 1:NP_731781.1 Gene:CG8630 / 41629 FlyBaseID:FBgn0038130 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001027500.1 Gene:scd / 613092 XenbaseID:XB-GENE-988226 Length:338 Species:Xenopus tropicalis


Alignment Length:307 Identity:157/307 - (51%)
Similarity:208/307 - (67%) Gaps:14/307 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 KKAEAKTPENKPYELEIVWRNVGLFVILHSMALYGLYLVFAE---SAYWELLPVYATMFLGGLGI 107
            ||.:.|.|      :::|||||.|..:||..|.|||:::.|.   :..|.:|    ...|..||:
 Frog    40 KKVDFKPP------IKLVWRNVILMALLHFGAFYGLFMIPAAKPITLAWAIL----CFMLSALGV 94

  Fly   108 TAGVHRLWSHKAYKAKLPLRIFLMLCQSLAFQNSIWEWTRDHRVHHKFTDTHADPHNSRRGFFFA 172
            |||.||||||::|||||||||||.:..|:||||.|:||.||||||||:::|.|||||:.|||||:
 Frog    95 TAGAHRLWSHRSYKAKLPLRIFLAVVNSMAFQNDIYEWARDHRVHHKYSETDADPHNAVRGFFFS 159

  Fly   173 HMGWLMCKKHPDVTSKGKQISMEDIEQDPVVMFQKKMYFVVMPICCFALPMIFPYYVMGSSLRVC 237
            |:|||:.:|||||..|||::.:.|::.|.|||||::.|.:.:.:.||.||.:.|:|....|..|.
 Frog   160 HIGWLLMRKHPDVIEKGKKLDLSDLKADKVVMFQRRNYKLSILVMCFILPTVIPWYFWDESFSVA 224

  Fly   238 FFTCSMLRFCLSLHFTWLVNSAAHFYGMKPYDVNVSAMNNKLVSTLTIGEGWHNYHHVFPWDYKA 302
            |:...:||:.|.|:.|||||||||.||.:|||..::...|.||:...||||:|||||.||:||..
 Frog   225 FYVPCLLRYALVLNATWLVNSAAHMYGNRPYDQTINPRENPLVAIGAIGEGFHNYHHTFPFDYST 289

  Fly   303 AELGTYSFNWTTAFIDVMAKIGQAYDLKFVSQEMVYKRVLRTGDGSH 349
            :|.| ..||.||.|||:|..:|.|.|.|.||:|.:..|..|||||||
 Frog   290 SEFG-LKFNITTGFIDLMCLLGLANDCKRVSKETIMARKKRTGDGSH 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8630NP_731781.1 Delta9-FADS-like 90..330 CDD:239582 128/239 (54%)
FA_desaturase 91..297 CDD:278890 111/205 (54%)
scdNP_001027500.1 Delta9-FADS-like 76..316 CDD:239582 128/244 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I11153
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D296120at33208
OrthoFinder 1 1.000 - - FOG0000495
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X207
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.