DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8630 and CG9747

DIOPT Version :9

Sequence 1:NP_731781.1 Gene:CG8630 / 41629 FlyBaseID:FBgn0038130 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001287604.1 Gene:CG9747 / 43591 FlyBaseID:FBgn0039754 Length:461 Species:Drosophila melanogaster


Alignment Length:347 Identity:149/347 - (42%)
Similarity:214/347 - (61%) Gaps:17/347 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 YELEIVWRNVGLFVILHSMALYGLYLVFAESAY--WELLPVYATM---FLGGL---GITAGVHRL 114
            ::..:.|..|....:||.:|  |:.|:    .|  .||.| |.|:   |:||:   |:|||.||.
  Fly   103 FQAPLKWDKVIQISLLHIVA--GICLL----TYPLRELNP-YTTIWSFFVGGVAGFGVTAGAHRF 160

  Fly   115 WSHKAYKAKLPLRIFLMLCQSLAFQNSIWEWTRDHRVHHKFTDTHADPHNSRRGFFFAHMGWLMC 179
            |:||:|||...||..||:|..:|.||::::|.||||||||:::|.|||||:.|||||:|:||||.
  Fly   161 WTHKSYKANTVLRSILMVCYCVAGQNTLYDWVRDHRVHHKYSETDADPHNANRGFFFSHVGWLMM 225

  Fly   180 KKHPDVTSKGKQISMEDIEQDPVVMFQKKMYFVVMPICCFALPMIFPYYVMGSSLRVCFFTCSML 244
            .|||:|..:|:||.|.||..||||.|.:|.:..:....||.||.:.|.|..|.:..:.|....:.
  Fly   226 LKHPEVLRRGRQIDMSDILADPVVRFHQKYFIPLKTFFCFILPTVIPVYCWGETWTLAFIQQCLF 290

  Fly   245 RFCLSLHFTWLVNSAAHFYGMKPYDVNVSAMNNKLVSTLTIGEGWHNYHHVFPWDYKAAELGTYS 309
            |:..||:|||.||||||.:|.:|||..:....|..||.|.:|||||||||||||||||||||.|:
  Fly   291 RYVSSLNFTWSVNSAAHLWGSRPYDKRIMPSENIYVSLLAMGEGWHNYHHVFPWDYKAAELGNYT 355

  Fly   310 FNWTTAFIDVMAKIGQAYDLKFVSQEMVYKRVLRTGDGSHIAAL--LDANNNSAIPTSELVAHLD 372
            .|:||..:|...|:|.|:::|..|:|:|.:.:.:.|||:|.:.|  .:...:..:..:.:|.|:.
  Fly   356 VNFTTMVLDAFHKLGWAWNMKQPSKELVRRTLEKYGDGTHASQLGGPEEFKDGVLAGATMVGHVH 420

  Fly   373 HEKEEHAIWGWDDKDISEEDRK 394
            :.:.......:|.:..|.|..|
  Fly   421 YAEVPDPELEYDAESSSTESAK 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8630NP_731781.1 Delta9-FADS-like 90..330 CDD:239582 127/247 (51%)
FA_desaturase 91..297 CDD:278890 107/211 (51%)
CG9747NP_001287604.1 Delta9-FADS-like 135..376 CDD:239582 124/241 (51%)
FA_desaturase 140..343 CDD:278890 102/202 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 124 1.000 Domainoid score I1803
eggNOG 1 0.900 - - E1_COG1398
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I1806
Isobase 1 0.950 - 0.837287 Normalized mean entropy S1208
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D296120at33208
OrthoFinder 1 1.000 - - FOG0000495
OrthoInspector 1 1.000 - - mtm1155
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11351
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X207
109.920

Return to query results.
Submit another query.