DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8630 and SPCC1281.06c

DIOPT Version :9

Sequence 1:NP_731781.1 Gene:CG8630 / 41629 FlyBaseID:FBgn0038130 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_588170.1 Gene:SPCC1281.06c / 2538753 PomBaseID:SPCC1281.06c Length:479 Species:Schizosaccharomyces pombe


Alignment Length:370 Identity:126/370 - (34%)
Similarity:189/370 - (51%) Gaps:46/370 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 PAASAAPSAAT---------------------PSQKVAKKAEAKTPENKPYELEIVWRNVGLFVI 72
            |:|:|..||.|                     |.:|...|| .|..:.:|:.::..||::..   
pombe     4 PSATAFSSATTQPTTEGNASMRKRTIPVVPSVPERKWDPKA-PKHIQEQPWTMQNWWRHLNW--- 64

  Fly    73 LHSMALYGL-----YLVFAESAYWELLPVYATMF--LGGLGITAGVHRLWSHKAYKAKLPLRIFL 130
            ||.|.::||     |.||......:.| ::|.::  ..|||||||.||||||:|||||.||..||
pombe    65 LHCMLIFGLPMIAIYGVFTTPLQTKTL-IFAIIYYAYSGLGITAGYHRLWSHRAYKAKKPLEYFL 128

  Fly   131 MLCQSLAFQNSIWEWTRDHRVHHKFTDTHADPHNSRRGFFFAHMGWLMCKKHPDVTSKGKQISME 195
            ....:.||:.||..|:||||.||::|||..||:|.::||::||:||::..::|....:.   .:.
pombe   129 AAGGAAAFEGSIRWWSRDHRAHHRYTDTDKDPYNVKKGFWYAHVGWMIILQNPRRIGRS---DVS 190

  Fly   196 DIEQDPVVMFQKKMYFVVMPICCFALPMIFPYYVMGSSLRVCFFTCSMLRFCLSLHFTWLVNSAA 260
            |:..||.|||..:.:..:.....|..|.:|...:.| ..|..:|...:.|.....|.|:.|||.|
pombe   191 DLNSDPFVMFNHRHFLPIASFMAFIFPSLFCGLLWG-DYRGGYFYAGVCRLVFVHHATFCVNSLA 254

  Fly   261 HFYGMKPYDVNVSAMNNKLVSTLTIGEGWHNYHHVFPWDYKAAELGTYSFNWTTAFIDVMAKIGQ 325
            |..|.:|:|...||.|:.:.:.:|:|||.|||||.||.||:.. |..|.::.|..||.:.:..|.
pombe   255 HLIGSQPFDDTNSARNHFITALVTLGEGNHNYHHAFPNDYRNG-LRWYEYDPTKIFIYIASLFGL 318

  Fly   326 AYDLKFVSQEMVYKRVLRTGDGSHIAALLD---ANNNSAIPTSEL 367
            ||:|.......:.|.:::...     .:||   |..|..||..:|
pombe   319 AYNLNTFPDNEIQKGIVQQKQ-----KVLDRWRAKLNWGIPLEQL 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8630NP_731781.1 Delta9-FADS-like 90..330 CDD:239582 95/241 (39%)
FA_desaturase 91..297 CDD:278890 83/207 (40%)
SPCC1281.06cNP_588170.1 OLE1 43..334 CDD:224316 111/300 (37%)
FA_desaturase 91..304 CDD:278890 89/218 (41%)
CYB5 345..474 CDD:227599 5/14 (36%)
Cyt-b5 360..432 CDD:278597
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 180 1.000 Domainoid score I809
eggNOG 1 0.900 - - E1_COG1398
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H136612
Inparanoid 1 1.050 207 1.000 Inparanoid score I967
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000495
OrthoInspector 1 1.000 - - otm47019
orthoMCL 1 0.900 - - OOG6_100468
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X207
TreeFam 1 0.960 - -
1110.720

Return to query results.
Submit another query.