DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ravus and CG43342

DIOPT Version :9

Sequence 1:NP_731779.1 Gene:Ravus / 41626 FlyBaseID:FBgn0038128 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001247238.1 Gene:CG43342 / 12798510 FlyBaseID:FBgn0263047 Length:180 Species:Drosophila melanogaster


Alignment Length:205 Identity:58/205 - (28%)
Similarity:84/205 - (40%) Gaps:72/205 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 DETEGDCEDDEKRTQELEAQNDLETEPVIKQQRRTSETDSQNSGMLDYLPLHVTINEGPQSLPT- 201
            |||..:..|:|::......::.:|||      |::.....:|:..|....|       |.|.|| 
  Fly     9 DETTSENGDNEEQKASYIKEDHIETE------RKSLLLIKRNNVALQKRQL-------PYSRPTP 60

  Fly   202 ---------------TVSAYPTSSATATVAPPCRITIKKVPVHSTPLSGMCQAQEINSKATITPI 251
                           .:|||                .|::         ..|..|:         
  Fly    61 QNRQELVESIEQDRKVLSAY----------------FKRL---------SSQRDEV--------- 91

  Fly   252 HTTPSYAARPLQSYQLQPLSPITPPRDSLELFFDSICATVKNLPPKLATEGKIRVMQLIGELELR 316
             |:|: ||.|...      ||: |.|:|.:|||:|.|.:||.||||||.|.|.|:.|:|.|.|:|
  Fly    92 -TSPN-AAPPAAD------SPV-PQRNSYDLFFESACISVKGLPPKLAAEAKSRISQIITEFEIR 147

  Fly   317 ALCEQEALSE 326
            |:.|.||..|
  Fly   148 AISEMEAQQE 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RavusNP_731779.1 BESS 278..312 CDD:281011 19/33 (58%)
CG43342NP_001247238.1 BESS 109..143 CDD:281011 19/33 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014341
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.