DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ace and NLGN2

DIOPT Version :9

Sequence 1:NP_001163600.1 Gene:Ace / 41625 FlyBaseID:FBgn0000024 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_065846.1 Gene:NLGN2 / 57555 HGNCID:14290 Length:835 Species:Homo sapiens


Alignment Length:610 Identity:174/610 - (28%)
Similarity:282/610 - (46%) Gaps:85/610 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 VVQTSSGPVRG--RSVT--VQGREVHVYTGIPYAKPPVEDLRFRKPVPAEPWHGVLDATRLSATC 104
            ||.|:.|.|||  |.:.  :.|..|. :.|:|||.||:...||:.|.....|.||.:||.|...|
Human    43 VVNTAYGRVRGVRRELNNEILGPVVQ-FLGVPYATPPLGARRFQPPEAPASWPGVRNATTLPPAC 106

  Fly   105 VQERYEYFPGFSGEEIWNPNT---------NVSEDCLYINVWAPAKARLRHGRGANGGEHPNGKQ 160
            .|..:...|... ..:|..:.         |.||||||:|::.|.:            :.|..|:
Human   107 PQNLHGALPAIM-LPVWFTDNLEAAATYVQNQSEDCLYLNLYVPTE------------DGPLTKK 158

  Fly   161 ADTDHLIHNGNPQNT----TNGLPILIWIYGGGFMTGSATLDIYNADIMAAVGNVIVASFQYRVG 221
            .|...|    ||.:|    ....|::::::||.:|.|  |.::::..::||.||||||:..||:|
Human   159 RDEATL----NPPDTDIRDPGKKPVMLFLHGGSYMEG--TGNMFDGSVLAAYGNVIVATLNYRLG 217

  Fly   222 AFGFLHLAPEMPSEFAEEAPGNVGLWDQALAIRWLKDNAHAFGGNPEWMTLFGESAGSSSVNAQL 286
            ..|||       |...:.|.||.||.||..|:|||.:|...|||:||.:|:||..||:|.||..:
Human   218 VLGFL-------STGDQAAKGNYGLLDQIQALRWLSENIAHFGGDPERITIFGSGAGASCVNLLI 275

  Fly   287 MSPVTRGLVKRGMMQSGTMNAPWSHMTSEKAVEIGKALINDCNCNASMLKTNPAHVMSCMRSVDA 351
            :|..:.||.::.:.||||..:.||  .:.:.::..:.|.....|:    :.:.|..:.|:|...:
Human   276 LSHHSEGLFQKAIAQSGTAISSWS--VNYQPLKYTRLLAAKVGCD----REDSAEAVECLRRKPS 334

  Fly   352 KTISVQQWNSYSGILSFPSAPTIDGAFLPADPMTLMKTADLKDYDILMGNVRDEGTYFLLYDFID 416
            :.:..|........::|  .|.:||..:|.||..||:..:..:||:|:|..:.||..|:    .|
Human   335 RELVDQDVQPARYHIAF--GPVVDGDVVPDDPEILMQQGEFLNYDMLIGVNQGEGLKFV----ED 393

  Fly   417 YFDKDDATALPRDKYL--EIMNNIFG--KATQAEREAIIFQYTSW-EGNPGYQNQQQIGRAVGDH 476
            ..:.:|..:.....:.  ..::|::|  :.....||.|.|.||.| :.:.|...::.:.....||
Human   394 SAESEDGVSASAFDFTVSNFVDNLYGYPEGKDVLRETIKFMYTDWADRDNGEMRRKTLLALFTDH 458

  Fly   477 FFTCPTNEYAQALAERGASVHYYYFTHRTSTSLWGEWMGVLHGDEIEYFFGQPLNNSLQYRPVER 541
            .:..|....|:..|:..:.|::|.|.|........||....||||:.|.||.|:..:....|...
Human   459 QWVAPAVATAKLHADYQSPVYFYTFYHHCQAEGRPEWADAAHGDELPYVFGVPMVGATDLFPCNF 523

  Fly   542 ELGKRMLSAVI-----EFAKTGNPAQDGEE----------------WPNFSKEDPVYYIFSTDDK 585
            .....|||||:     .|||||:|.|...:                |..|:.::..|.......:
Human   524 SKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVVWSKFNSKEKQYLHIGLKPR 588

  Fly   586 IEKLARGPLAARCSFWNDYLPKVRS 610
            :....|   |.:.:||.:.:|.:.:
Human   589 VRDNYR---ANKVAFWLELVPHLHN 610

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AceNP_001163600.1 COesterase 41..601 CDD:278561 171/599 (29%)
NLGN2NP_065846.1 COesterase 41..601 CDD:278561 171/599 (29%)
Aes <170..>268 CDD:223730 42/106 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 623..668
Required for interaction with LHFPL4. /evidence=ECO:0000250|UniProtKB:Q69ZK9 678..698
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 790..835
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.