DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8476 and AT3G17830

DIOPT Version :10

Sequence 1:NP_731777.1 Gene:CG8476 / 41624 FlyBaseID:FBgn0038127 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_188410.2 Gene:AT3G17830 / 821051 AraportID:AT3G17830 Length:517 Species:Arabidopsis thaliana


Alignment Length:80 Identity:26/80 - (32%)
Similarity:42/80 - (52%) Gaps:0/80 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 FGSRFTYQSQPMSQLRAENHYQVLNVPVGSSDREIKRAFIELSKKYHPDANSQTRDSEVFMKICE 83
            ||....|:.:.::.....:||..|||...::.:|||.::.:|::|||||.|......:.|.:|..
plant    45 FGISGGYRRRVITMAAGTDHYSTLNVNRNATLQEIKSSYRKLARKYHPDMNKNPGAEDKFKQISA 109

  Fly    84 AYQTLHRVNSRQIYD 98
            ||:.|.....|..||
plant   110 AYEVLSDEEKRSAYD 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8476NP_731777.1 DnaJ 37..98 CDD:395170 21/60 (35%)
AT3G17830NP_188410.2 DnaJ_bact 63..417 CDD:274090 23/62 (37%)

Return to query results.
Submit another query.