DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8476 and AT2G22360

DIOPT Version :10

Sequence 1:NP_731777.1 Gene:CG8476 / 41624 FlyBaseID:FBgn0038127 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_565533.1 Gene:AT2G22360 / 816768 AraportID:AT2G22360 Length:442 Species:Arabidopsis thaliana


Alignment Length:80 Identity:29/80 - (36%)
Similarity:43/80 - (53%) Gaps:9/80 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GSRFTYQSQPMSQLRAE-NHYQVLNVPVGSSDREIKRAFIELSKKYHPDANSQTRDSEVFMKICE 83
            |||||        :||: ::|.||.|...::..|||.|:.:|::.||||.|......|.|.:|..
plant    76 GSRFT--------VRADADYYSVLGVSKNATKAEIKSAYRKLARNYHPDVNKDPGAEEKFKEISN 132

  Fly    84 AYQTLHRVNSRQIYD 98
            ||:.|.....:.:||
plant   133 AYEVLSDDEKKSLYD 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8476NP_731777.1 DnaJ 37..98 CDD:395170 20/60 (33%)
AT2G22360NP_565533.1 DnaJ_bact 86..432 CDD:274090 22/62 (35%)

Return to query results.
Submit another query.