DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8476 and Dph4

DIOPT Version :10

Sequence 1:NP_731777.1 Gene:CG8476 / 41624 FlyBaseID:FBgn0038127 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_649559.1 Gene:Dph4 / 40686 FlyBaseID:FBgn0037350 Length:183 Species:Drosophila melanogaster


Alignment Length:72 Identity:24/72 - (33%)
Similarity:38/72 - (52%) Gaps:10/72 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 YQVLNVPVGSSDREIKRAFIELSKKYHPD---------ANSQTRDSEVFMKICEAYQTLHRVNSR 94
            |::||||..:|..|||.::.:|..:.|||         ..|:.::|: |..|..|:.||.....|
  Fly     5 YELLNVPSTASFDEIKCSYKQLILQCHPDKLRQLDDPNPGSEAQNSD-FNAINAAWNTLKDPIRR 68

  Fly    95 QIYDSRL 101
            :.||:.|
  Fly    69 KHYDAEL 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8476NP_731777.1 DnaJ 37..98 CDD:395170 21/67 (31%)
Dph4NP_649559.1 DnaJ 3..72 CDD:395170 21/67 (31%)
zf-CSL <138..179 CDD:398744
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.