DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and Pi15

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_444421.2 Gene:Pi15 / 94227 MGIID:1934659 Length:269 Species:Mus musculus


Alignment Length:276 Identity:75/276 - (27%)
Similarity:117/276 - (42%) Gaps:73/276 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMQPSAVLLTTIMIISCE-----VAFACNGKIIASGITAEERSI--------------------- 39
            |:..|||.|..::.:.||     :....:..:.|:..|..|.::                     
Mouse    12 MIMNSAVSLVILLSLLCEAHTVVLLNPTDSSLPANNFTDTEAALSTPLESADIPKARRKRYISQN 76

  Fly    40 ----ILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFRHDPHRTINRFTM 100
                ||..||::|..|.       |.|.||..:|||:.||..|:.||..|.:.|.|...: || :
Mouse    77 DMIAILDYHNQVRGKVF-------PPAANMEYMVWDENLAKSAEAWAATCIWDHGPSYLL-RF-L 132

  Fly   101 GQNLAIIWSTAPLDADDGDFPSRIQ---SWFNEVQKYSFG-----------DAWSPKTGHYSQLV 151
            ||||::         ..|.:.|.:|   .|::||:.|:|.           ..:.|...||:|:|
Mouse   133 GQNLSV---------RTGRYRSILQLVKPWYDEVKDYAFPYPQDCNPRCPMRCFGPMCTHYTQMV 188

  Fly   152 WGETSLVGCGYAEYKDTSKYNKLY------VCNYGPGGNVVGYNPYEVGKPSCSTYGMKPSSRYQ 210
            |..::.:||.....::.:.:..::      ||||.|.||.:|..||:||.| ||:  ..||  |.
Mouse   189 WATSNRIGCAIHTCQNMNVWGSVWRRAVYLVCNYAPKGNWIGEAPYKVGVP-CSS--CPPS--YG 248

  Fly   211 GLCAAPGSSPAANSVY 226
            |.|......|...:.|
Mouse   249 GACTDNLCFPGVTTNY 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 46/187 (25%)
Pi15NP_444421.2 SCP_euk 80..223 CDD:240180 46/160 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841170
Domainoid 1 1.000 72 1.000 Domainoid score I9265
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43032
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6223
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.780

Return to query results.
Submit another query.