DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and PRY1

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_012456.1 Gene:PRY1 / 853366 SGDID:S000003615 Length:299 Species:Saccharomyces cerevisiae


Alignment Length:160 Identity:48/160 - (30%)
Similarity:75/160 - (46%) Gaps:44/160 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 SIILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFRHDPHRTINRF--TM 100
            |.:|.|||:.|.:     :...|.      :.|.|.||:.||.:|||    :|...|:...  ..
Yeast   164 SSVLAEHNKKRAL-----HKDTPA------LSWSDTLASYAQDYADN----YDCSGTLTHSGGPY 213

  Fly   101 GQNLAIIWSTAPLDADDGDFPSRIQSWFNEVQKYSFGD-AWSPKTGHYSQLVWGETSLVGCG--- 161
            |:|||:.:          |.|:.:.:|:||:..|.|.: .:|..|||::|:||..|:.||||   
Yeast   214 GENLALGY----------DGPAAVDAWYNEISNYDFSNPGFSSNTGHFTQVVWKSTTQVGCGIKT 268

  Fly   162 ----YAEYKDTSKYNKLYVCNYGPGGNVVG 187
                :.:|         .:|:|.|.||..|
Yeast   269 CGGAWGDY---------VICSYDPAGNYEG 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 43/151 (28%)
PRY1NP_012456.1 CAP_PRY1-like 166..289 CDD:349403 46/156 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344515
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.