DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and AT1G50050

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_175427.1 Gene:AT1G50050 / 841429 AraportID:AT1G50050 Length:226 Species:Arabidopsis thaliana


Alignment Length:216 Identity:49/216 - (22%)
Similarity:75/216 - (34%) Gaps:62/216 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 LQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWAD----NCQFRHDPHRTINRFTMG 101
            |..||..|         .|.|..|   :|||..:||.|..:|:    :|.....     ...:.|
plant    31 LNTHNTAR---------AQVGVAN---VVWDTVVAAYATNYANARKVDCSLTPS-----TGGSYG 78

  Fly   102 QNLAIIWSTAPLDADDGDFP--SRIQSWFNEVQKYSF---GDAWSPKTGHYSQLVWGETSLVGCG 161
            :|||        :.::..|.  :.:..|.||...|::   ....:.:..||:|:||..:..:||.
plant    79 ENLA--------NGNNALFTGVAAVNLWVNEKPYYNYTANACIGAQQCKHYTQVVWSNSVKIGCA 135

  Fly   162 YAEYKDTSKYNKLYVCNYGPGGNVVGYNPYEVGKPSCSTYGMKPSSRYQGLCAAPGSSPAANSVY 226
            ..            :||  .||..||.| |:......|........:.:||.|:.......|.  
plant   136 RV------------LCN--NGGYFVGCN-YDASAALKSRKITASVRQTRGLGASAACGQLRNK-- 183

  Fly   227 GANTIETYEYGYNSSPSSQTA 247
                       :..|||..||
plant   184 -----------FQKSPSLATA 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 33/147 (22%)
AT1G50050NP_175427.1 SCP 27..151 CDD:294090 38/159 (24%)
Radical_SAM <155..185 CDD:302752 5/42 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.