DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and AT1G01310

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_171638.2 Gene:AT1G01310 / 839333 AraportID:AT1G01310 Length:241 Species:Arabidopsis thaliana


Alignment Length:157 Identity:48/157 - (30%)
Similarity:71/157 - (45%) Gaps:38/157 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 HNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWAD----NCQFRHD--PHRTINRFTMGQ 102
            ||.:|..|      |:|..:      ||..|||.|:.||:    :|:..|.  |:.. |.|..|:
plant    92 HNLVRARV------GEPPFQ------WDGRLAAYARTWANQRVGDCRLVHSNGPYGE-NIFWAGK 143

  Fly   103 NLAIIWSTAPLDADDGDFPSRIQSWFNEVQKYSF-GDAWSPK--TGHYSQLVWGETSLVGCGYAE 164
            |   .||  |.|.        :..|.:|.:.|.. |:...|:  .|||:|:||.:::.|||...:
plant   144 N---NWS--PRDI--------VNVWADEDKFYDVKGNTCEPQHMCGHYTQIVWRDSTKVGCASVD 195

  Fly   165 YKDTSKYNKLYVCNYGPGGNVVGYNPY 191
            ..:...|   .:|.|.|.||..|.||:
plant   196 CSNGGVY---AICVYNPPGNYEGENPF 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 41/144 (28%)
AT1G01310NP_171638.2 SCP_PR-1_like 87..219 CDD:240181 47/155 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.