DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and CRISPLD2

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_113664.1 Gene:CRISPLD2 / 83716 HGNCID:25248 Length:497 Species:Homo sapiens


Alignment Length:278 Identity:87/278 - (31%)
Similarity:121/278 - (43%) Gaps:72/278 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IASGITAEERSIILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFRHDPH 92
            :...|..|::..||..||:||..|       ||.|.||..:.|||||...|..||..|.:.|.| 
Human    47 VRRAIPREDKEEILMLHNKLRGQV-------QPQASNMEYMTWDDELEKSAAAWASQCIWEHGP- 103

  Fly    93 RTINRFTMGQNLAIIWSTAPLDADDGDFPS---RIQSWFNEVQKYSFG-----DAWSPK--TG-- 145
             |....::||||...|         |.:.|   .:|||::||:.|::.     :.|.|:  :|  
Human   104 -TSLLVSIGQNLGAHW---------GRYRSPGFHVQSWYDEVKDYTYPYPSECNPWCPERCSGPM 158

  Fly   146 --HYSQLVWGETSLVGCG---------YAEYKDTSKYNKLYVCNYGPGGNVVGYNPYEVGKPSCS 199
              ||:|:||..|:.:||.         :.|..:.:.|   :||||.|.||.:|..||:.|:| ||
Human   159 CTHYTQIVWATTNKIGCAVNTCRKMTVWGEVWENAVY---FVCNYSPKGNWIGEAPYKNGRP-CS 219

  Fly   200 TYGMKPSSRYQGLCAAPGSSPAANSVYGANTIETYEYGYNSSPSSQTAN-NNPPTNNINKSQFSY 263
            .  ..||  |.|.|       ..|..|..   |||      :|..:|.. |...|..|.:....:
Human   220 E--CPPS--YGGSC-------RNNLCYRE---ETY------TPKPETDEMNEVETAPIPEENHVW 264

  Fly   264 NQPR------PKPVQTIN 275
            .|||      ||....:|
Human   265 LQPRVMRPTKPKKTSAVN 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 53/165 (32%)
CRISPLD2NP_113664.1 SCP_euk 56..201 CDD:240180 53/165 (32%)
LCCL 286..370 CDD:128866
LCCL 387..479 CDD:128866
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151106
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.