DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and Crispld1

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001343480.1 Gene:Crispld1 / 83691 MGIID:1934666 Length:500 Species:Mus musculus


Alignment Length:257 Identity:72/257 - (28%)
Similarity:115/257 - (44%) Gaps:54/257 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ITAEERSIILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFRHDPHRTIN 96
            ||..:...||..||:||..|       .|.|.||..:.||.||...|:.||:.|.:.|.|...:.
Mouse    57 ITDNDMQSILDLHNKLRSQV-------YPTASNMEYMTWDVELERSAESWAEMCLWEHGPASLLP 114

  Fly    97 RFTMGQNLAIIWSTAPLDADDGDF--PS-RIQSWFNEVQKYSFG-----DAW------SPKTGHY 147
              ::||||...|         |.:  |: .:|:|::||:.:|:.     |.:      .|...||
Mouse   115 --SIGQNLGAHW---------GRYRPPTFHVQAWYDEVRDFSYPYENECDPYCPFRCSGPVCTHY 168

  Fly   148 SQLVWGETSLVGCGYAEYKDTSKYNKLY------VCNYGPGGNVVGYNPYEVGKPSCS----TYG 202
            :|:||..:|.:||......:.:.:.:::      ||||.|.||..|:.||:.|:| ||    ::|
Mouse   169 TQVVWATSSRIGCAVNLCHNMNIWGQIWPKAVYLVCNYSPKGNWWGHAPYKHGRP-CSACPPSFG 232

  Fly   203 MKPSSRYQGLCAAPGSSPAANSVYGANTIETYEYGYNSS----PSSQTANNNPPTNNINKSQ 260
               ....:.||...||    :..|.....||.|.....|    ...:|.:::...|::..:|
Mouse   233 ---GGCRENLCYKEGS----DRYYTPREEETNEIERQQSQVHDTHVRTRSDDSDRNDVISTQ 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 46/162 (28%)
Crispld1NP_001343480.1 CAP_CRISPLD1 62..207 CDD:349407 46/162 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 258..281 3/22 (14%)
LCCL 291..375 CDD:128866
LCCL 394..492 CDD:367672
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841166
Domainoid 1 1.000 72 1.000 Domainoid score I9265
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43032
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.