DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and AT5G57625

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_680450.1 Gene:AT5G57625 / 835867 AraportID:AT5G57625 Length:207 Species:Arabidopsis thaliana


Alignment Length:161 Identity:52/161 - (32%)
Similarity:72/161 - (44%) Gaps:35/161 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 IILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFRHDPHRTINRFTMGQN 103
            :.|..||.||..:      |.|      .::||.:||:.|..||:  |.|:|...|.:....|:|
plant    74 LFLDPHNALRSGL------GLP------PLIWDGKLASYATWWAN--QRRYDCSLTHSTGPYGEN 124

  Fly   104 LAIIW----STAPLDADDGDFPSRIQSWFNEVQKYSFG----DAWSPKTGHYSQLVWGETSLVGC 160
            |  .|    |.||..|        :|||..|.:.|:..    |. |...|||:|:||.:|..:||
plant   125 L--FWGSGSSWAPGFA--------VQSWIVEGRSYNHNTNSCDG-SGMCGHYTQMVWRDTKRLGC 178

  Fly   161 GYAEYKDTSKYNKLYVCNYGPGGNVVGYNPY 191
            .....::.:  .....|||.|.||.||..||
plant   179 ARVVCENGA--GVFITCNYDPPGNYVGEKPY 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 44/148 (30%)
AT5G57625NP_680450.1 CAP_PR-1 72..207 CDD:349400 50/159 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100188
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.