DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and AT4G33720

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_195098.1 Gene:AT4G33720 / 829514 AraportID:AT4G33720 Length:163 Species:Arabidopsis thaliana


Alignment Length:158 Identity:43/158 - (27%)
Similarity:69/158 - (43%) Gaps:35/158 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 LQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWAD----NCQFRHDPHRTINRFTMG 101
            |..|||.|..|..|            .:.||:::||.|:.:|:    :|..:|      :..:.|
plant    34 LAVHNRARAEVGVG------------PLRWDEKVAAYARNYANQRKGDCAMKH------SSGSYG 80

  Fly   102 QNLAIIWSTAPLDADDGDFPSRIQSWFNEVQKYSFGD---AWSPKTGHYSQLVWGETSLVGCGYA 163
            :|:|  ||:..:..     .:.:..|.:|...|.:..   ||..:.|||:|:||..:..:||...
plant    81 ENIA--WSSGSMTG-----VAAVDMWVDEQFDYDYDSNTCAWDKQCGHYTQVVWRNSERLGCAKV 138

  Fly   164 EYKDTSKYNKLYVCNYGPGGNVVGYNPY 191
            ...:...:   ..|||.|.||.||..||
plant   139 RCNNGQTF---ITCNYDPPGNWVGEWPY 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 35/145 (24%)
AT4G33720NP_195098.1 CAP_PR-1 30..163 CDD:349400 41/156 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100188
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.